Recombinant Human ATP5F1 protein, GST-tagged

Cat.No. : ATP5F1-981H
Product Overview : Human ATP5F1 full-length ORF ( NP_001679.2, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel. [provided by RefSeq, Jul 2008]
Molecular Mass : 55.3 kDa
AA Sequence : MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 [ Homo sapiens ]
Official Symbol ATP5F1
Synonyms ATP5F1; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1 , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase subunit b, mitochondrial; ATPase subunit b; H+-ATP synthase subunit b; ATP synthase B chain, mitochondrial; cell proliferation-inducing protein 47; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1; PIG47; MGC24431;
Gene ID 515
mRNA Refseq NM_001688
Protein Refseq NP_001679
MIM 603270
UniProt ID P24539

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP5F1 Products

Required fields are marked with *

My Review for All ATP5F1 Products

Required fields are marked with *

0
cart-icon
0
compare icon