Recombinant Human ATP6V1C2 protein, GST-tagged

Cat.No. : ATP6V1C2-1004H
Product Overview : Human ATP6V1C2 full-length ORF ( AAH12142.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A,three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain C subunit isoforms. [provided by RefSeq, Jul 2008]
Molecular Mass : 70.3 kDa
AA Sequence : MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYDTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMARLLSDKKQQYGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFHIDLSLLD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 [ Homo sapiens ]
Official Symbol ATP6V1C2
Synonyms ATP6V1C2; ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2; ATPase, H+ transporting, lysosomal 42kD, V1 subunit C isoform 2 , ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2; V-type proton ATPase subunit C 2; ATP6C2; VMA5; V-ATPase C2 subunit; V-ATPase subunit C 2; vacuolar proton pump subunit C 2;
Gene ID 245973
mRNA Refseq NM_001039362
Protein Refseq NP_001034451
UniProt ID Q8NEY4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP6V1C2 Products

Required fields are marked with *

My Review for All ATP6V1C2 Products

Required fields are marked with *

0
cart-icon