Recombinant Human ATP6V1E1 protein, GST-tagged
Cat.No. : | ATP6V1E1-1006H |
Product Overview : | Human ATP6V1E1 full-length ORF ( AAH04443, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 50.60 kDa |
AA Sequence : | MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP6V1E1 ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 [ Homo sapiens ] |
Official Symbol | ATP6V1E1 |
Synonyms | ATP6V1E1; ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1; ATP6E, ATP6V1E, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD , ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 1; V-type proton ATPase subunit E 1; ATP6E2; P31; Vma4; V-ATPase, subunit E; V-ATPase subunit E 1; V-ATPase 31 kDa subunit; vacuolar proton pump subunit E 1; H+-transporting ATP synthase chain E, vacuolar; H(+)-transporting two-sector ATPase, 31kDa subunit; ATP6E; ATP6V1E; |
Gene ID | 529 |
mRNA Refseq | NM_001039366 |
Protein Refseq | NP_001034455 |
MIM | 108746 |
UniProt ID | P36543 |
◆ Recombinant Proteins | ||
ATP6V1E1-1006H | Recombinant Human ATP6V1E1 protein, GST-tagged | +Inquiry |
Atp6v1e1-673M | Recombinant Mouse Atp6v1e1 Protein, MYC/DDK-tagged | +Inquiry |
ATP6V1E1-549R | Recombinant Rat ATP6V1E1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP6V1E1-386H | Recombinant Human ATP6V1E1, T7-tagged | +Inquiry |
ATP6V1E1-1537HF | Recombinant Full Length Human ATP6V1E1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6V1E1-8580HCL | Recombinant Human ATP6V1E1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6V1E1 Products
Required fields are marked with *
My Review for All ATP6V1E1 Products
Required fields are marked with *