Recombinant Human ATP6V1F protein, GST-tagged
| Cat.No. : | ATP6V1F-1008H |
| Product Overview : | Human ATP6V1F full-length ORF ( NP_004222.2, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is the V1 domain F subunit protein. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 39.8 kDa |
| AA Sequence : | MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATP6V1F ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F [ Homo sapiens ] |
| Official Symbol | ATP6V1F |
| Synonyms | ATP6V1F; ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F; V-type proton ATPase subunit F; ATP6S14; VATF; Vma7; V-ATPase F subunit; V-ATPase subunit F; ATPase, vacuolar, 14 kD; V-ATPase 14 kDa subunit; vacuolar proton pump F subunit; vacuolar proton pump subunit F; vacuolar ATP synthase subunit F; adenosinetriphosphatase 14k chain; H(+)-transporting two-sector ATPase, 14kD subunit; MGC117321; MGC126037; MGC126038; |
| Gene ID | 9296 |
| mRNA Refseq | NM_001198909 |
| Protein Refseq | NP_001185838 |
| MIM | 607160 |
| UniProt ID | Q16864 |
| ◆ Recombinant Proteins | ||
| ATP6V1F-10048H | Recombinant Human ATP6V1F protein(Met1-Arg119), GST-tagged | +Inquiry |
| ATP6V1F-550R | Recombinant Rat ATP6V1F Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP6V1F-882M | Recombinant Mouse ATP6V1F Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP6V1F-1115HF | Recombinant Full Length Human ATP6V1F Protein, GST-tagged | +Inquiry |
| ATP6V1F-2166M | Recombinant Mouse ATP6V1F Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP6V1F-8578HCL | Recombinant Human ATP6V1F 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6V1F Products
Required fields are marked with *
My Review for All ATP6V1F Products
Required fields are marked with *
