Recombinant Human ATP6V1G3 protein, GST-tagged
Cat.No. : | ATP6V1G3-1011H |
Product Overview : | Human ATP6V1G3 full-length ORF ( NP_573569.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 40.3 kDa |
AA Sequence : | MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP6V1G3 ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 [ Homo sapiens ] |
Official Symbol | ATP6V1G3 |
Synonyms | ATP6V1G3; ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3; ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3 , ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3; V-type proton ATPase subunit G 3; ATP6G3; Vma10; V-ATPase G3 subunit; V-ATPase G subunit 3; V-ATPase subunit G 3; V-ATPase 13 kDa subunit 3; vacuolar proton pump G subunit 3; vacuolar proton pump subunit G 3; vacuolar proton pump, subunit G3; vacuolar ATP synthase subunit G 3; ATPase, H+ transporting, lysosomal (vacuolar proton pump) subunit G3; MGC119810; MGC119813; |
Gene ID | 127124 |
mRNA Refseq | NM_133262 |
Protein Refseq | NP_573569 |
UniProt ID | Q96LB4 |
◆ Recombinant Proteins | ||
ATP6V1G3-883M | Recombinant Mouse ATP6V1G3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP6V1G3-1333HF | Recombinant Full Length Human ATP6V1G3 Protein, GST-tagged | +Inquiry |
ATP6V1G3-2169M | Recombinant Mouse ATP6V1G3 Protein | +Inquiry |
Atp6v1g3-1777M | Recombinant Mouse Atp6v1g3 Protein, Myc/DDK-tagged | +Inquiry |
ATP6V1G3-1011H | Recombinant Human ATP6V1G3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6V1G3-8574HCL | Recombinant Human ATP6V1G3 293 Cell Lysate | +Inquiry |
ATP6V1G3-8575HCL | Recombinant Human ATP6V1G3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6V1G3 Products
Required fields are marked with *
My Review for All ATP6V1G3 Products
Required fields are marked with *