Recombinant Human ATP6V1G3 protein, GST-tagged

• Cat.No.: ATP6V1G3-1011H
• Product Overview: Human ATP6V1G3 full-length ORF ( NP_573569.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 40.3 kDa
• AA Sequence: MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP6V1G3 ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 [ Homo sapiens ]
• Official Symbol: ATP6V1G3
• Synonyms: ATP6V1G3; ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3; ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3 , ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3; V-type proton ATPase subunit G 3; ATP6G3; Vma10; V-ATPase G3 subunit; V-ATPase G subunit 3; V-ATPase subunit G 3; V-ATPase 13 kDa subunit 3; vacuolar proton pump G subunit 3; vacuolar proton pump subunit G 3; vacuolar proton pump, subunit G3; vacuolar ATP synthase subunit G 3; ATPase, H+ transporting, lysosomal (vacuolar proton pump) subunit G3; MGC119810; MGC119813
• Gene ID: 127124
• mRNA Refseq: NM_133262
• Protein Refseq: NP_573569
• UniProt ID: Q96LB4