Recombinant Human ATP6V1G3 protein, GST-tagged

Cat.No. : ATP6V1G3-1011H
Product Overview : Human ATP6V1G3 full-length ORF ( NP_573569.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 40.3 kDa
AA Sequence : MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP6V1G3 ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 [ Homo sapiens ]
Official Symbol ATP6V1G3
Synonyms ATP6V1G3; ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3; ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3 , ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3; V-type proton ATPase subunit G 3; ATP6G3; Vma10; V-ATPase G3 subunit; V-ATPase G subunit 3; V-ATPase subunit G 3; V-ATPase 13 kDa subunit 3; vacuolar proton pump G subunit 3; vacuolar proton pump subunit G 3; vacuolar proton pump, subunit G3; vacuolar ATP synthase subunit G 3; ATPase, H+ transporting, lysosomal (vacuolar proton pump) subunit G3; MGC119810; MGC119813;
Gene ID 127124
mRNA Refseq NM_133262
Protein Refseq NP_573569
UniProt ID Q96LB4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP6V1G3 Products

Required fields are marked with *

My Review for All ATP6V1G3 Products

Required fields are marked with *

0
cart-icon