Recombinant Human ATP7B protein, GST-tagged
| Cat.No. : | ATP7B-1014H |
| Product Overview : | Human ATP7B partial ORF ( NP_000044, 1372 a.a. - 1465 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD). [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.08 kDa |
| AA Sequence : | QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATP7B ATPase, Cu++ transporting, beta polypeptide [ Homo sapiens ] |
| Official Symbol | ATP7B |
| Synonyms | ATP7B; ATPase, Cu++ transporting, beta polypeptide; ATPase, Cu++ transporting, beta polypeptide (Wilson disease) , WND; copper-transporting ATPase 2; Wilson disease; copper pump 2; Wilson disease-associated protein; ATPase, Cu(2+)- transporting, beta polypeptide; WD; PWD; WC1; WND; |
| Gene ID | 540 |
| mRNA Refseq | NM_000053 |
| Protein Refseq | NP_000044 |
| MIM | 606882 |
| UniProt ID | P35670 |
| ◆ Recombinant Proteins | ||
| ATP7B-33HFL | Recombinant Full Length Human ATP7B Protein, C-Flag-tagged | +Inquiry |
| ATP7B-467H | Recombinant Human ATP7B Protein, His-tagged | +Inquiry |
| ATP7B-3895H | Recombinant Human ATP7B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Atp7b-275M | Recombinant Mouse Atp7b Protein, His-tagged | +Inquiry |
| ATP7B-02H | Recombinant Human ATP7B Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP7B-498HKCL | Human ATP7B Knockdown Cell Lysate | +Inquiry |
| ATP7B-8572HCL | Recombinant Human ATP7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP7B Products
Required fields are marked with *
My Review for All ATP7B Products
Required fields are marked with *
