Recombinant Human ATPAF1 protein, GST-tagged
Cat.No. : | ATPAF1-1020H |
Product Overview : | Human ATPAF1 full-length ORF (BAB15316.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 62.8 kDa |
AA Sequence : | MAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADGSGVGAEAELQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATPAF1 ATP synthase mitochondrial F1 complex assembly factor 1 [ Homo sapiens ] |
Official Symbol | ATPAF1 |
Synonyms | ATPAF1; ATP synthase mitochondrial F1 complex assembly factor 1; ATP11; Atp11p; FLJ22351; homolog of yeast ATP11; ATP11p; FLJ55378; FLJ60653; MGC88060; |
Gene ID | 64756 |
mRNA Refseq | NM_001042546 |
Protein Refseq | NP_001036011 |
MIM | 608917 |
UniProt ID | Q5TC12 |
◆ Recombinant Proteins | ||
ATPAF1-2982H | Recombinant Human ATPAF1 Protein, MYC/DDK-tagged | +Inquiry |
ATPAF1-2623Z | Recombinant Zebrafish ATPAF1 | +Inquiry |
ATPAF1-3821H | Recombinant Human ATPAF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATPAF1-10058H | Recombinant Human ATPAF1, GST-tagged | +Inquiry |
ATPAF1-3625H | Recombinant Human ATPAF1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATPAF1 Products
Required fields are marked with *
My Review for All ATPAF1 Products
Required fields are marked with *
0
Inquiry Basket