Recombinant Human ATPAF1 protein, GST-tagged

Cat.No. : ATPAF1-1020H
Product Overview : Human ATPAF1 full-length ORF (BAB15316.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Aug 2011]
Molecular Mass : 62.8 kDa
AA Sequence : MAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADGSGVGAEAELQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATPAF1 ATP synthase mitochondrial F1 complex assembly factor 1 [ Homo sapiens ]
Official Symbol ATPAF1
Synonyms ATPAF1; ATP synthase mitochondrial F1 complex assembly factor 1; ATP11; Atp11p; FLJ22351; homolog of yeast ATP11; ATP11p; FLJ55378; FLJ60653; MGC88060;
Gene ID 64756
mRNA Refseq NM_001042546
Protein Refseq NP_001036011
MIM 608917
UniProt ID Q5TC12

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATPAF1 Products

Required fields are marked with *

My Review for All ATPAF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon