Recombinant Human ATPAF1 protein, His-tagged
Cat.No. : | ATPAF1-3625H |
Product Overview : | Recombinant Human ATPAF1 protein(25-328 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-328 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | GLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADGSGVGAEAELQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | ATPAF1 |
Synonyms | ATPAF1; ATP synthase mitochondrial F1 complex assembly factor 1; ATP11; Atp11p; FLJ22351; homolog of yeast ATP11; ATP11p; FLJ55378; FLJ60653; MGC88060; |
Gene ID | 64756 |
mRNA Refseq | NM_001042546 |
Protein Refseq | NP_001036011 |
MIM | 608917 |
UniProt ID | Q5TC12 |
◆ Recombinant Proteins | ||
ATPAF1-1277HF | Recombinant Full Length Human ATPAF1 Protein, GST-tagged | +Inquiry |
ATPAF1-10058H | Recombinant Human ATPAF1, GST-tagged | +Inquiry |
ATPAF1-2623Z | Recombinant Zebrafish ATPAF1 | +Inquiry |
ATPAF1-3821H | Recombinant Human ATPAF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATPAF1-2982H | Recombinant Human ATPAF1 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATPAF1 Products
Required fields are marked with *
My Review for All ATPAF1 Products
Required fields are marked with *
0
Inquiry Basket