Recombinant Human ATR protein, GST-tagged
Cat.No. : | ATR-1026H |
Product Overview : | Human ATR partial ORF ( NP_001175, 2545 a.a. - 2644 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs the PI3/PI4-kinase family, and is most closely related to ATM, a protein kinase encoded by the gene mutated in ataxia telangiectasia. This protein and ATM share similarity with Schizosaccharomyces pombe rad3, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This kinase has been shown to phosphorylate checkpoint kinase CHK1, checkpoint proteins RAD17, and RAD9, as well as tumor suppressor protein BRCA1. Mutations of this gene are associated with Seckel syndrome. An alternatively spliced transcript variant of this gene has been reported, however, its full length nature is not known. Transcript variants utilizing alternative polyA sites exist. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATR ataxia telangiectasia and Rad3 related [ Homo sapiens ] |
Official Symbol | ATR |
Synonyms | ATR; ataxia telangiectasia and Rad3 related; serine/threonine-protein kinase ATR; FRP1; MEC1; mitosis entry checkpoint 1; homolog (S. cerevisiae); SCKL; SCKL1; protein kinase ATR; Rad3 related protein; FRAP-related protein 1; FRAP-related protein-1; MEC1, mitosis entry checkpoint 1, homolog; ataxia telangiectasia and Rad3-related protein; FCTCS; |
Gene ID | 545 |
mRNA Refseq | NM_001184 |
Protein Refseq | NP_001175 |
MIM | 601215 |
UniProt ID | Q13535 |
◆ Recombinant Proteins | ||
ATR-4932H | Recombinant Human ATR Protein, GST-tagged | +Inquiry |
ATR-1768H | Recombinant Human ATR protein, His & T7-tagged | +Inquiry |
ATR-1026H | Recombinant Human ATR protein, GST-tagged | +Inquiry |
ATR-1136H | Recombinant Human ATR Protein (Ala2353-Met2644), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATR Products
Required fields are marked with *
My Review for All ATR Products
Required fields are marked with *
0
Inquiry Basket