Recombinant Human ATR protein, GST-tagged

Cat.No. : ATR-1026H
Product Overview : Human ATR partial ORF ( NP_001175, 2545 a.a. - 2644 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs the PI3/PI4-kinase family, and is most closely related to ATM, a protein kinase encoded by the gene mutated in ataxia telangiectasia. This protein and ATM share similarity with Schizosaccharomyces pombe rad3, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This kinase has been shown to phosphorylate checkpoint kinase CHK1, checkpoint proteins RAD17, and RAD9, as well as tumor suppressor protein BRCA1. Mutations of this gene are associated with Seckel syndrome. An alternatively spliced transcript variant of this gene has been reported, however, its full length nature is not known. Transcript variants utilizing alternative polyA sites exist. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATR ataxia telangiectasia and Rad3 related [ Homo sapiens ]
Official Symbol ATR
Synonyms ATR; ataxia telangiectasia and Rad3 related; serine/threonine-protein kinase ATR; FRP1; MEC1; mitosis entry checkpoint 1; homolog (S. cerevisiae); SCKL; SCKL1; protein kinase ATR; Rad3 related protein; FRAP-related protein 1; FRAP-related protein-1; MEC1, mitosis entry checkpoint 1, homolog; ataxia telangiectasia and Rad3-related protein; FCTCS;
Gene ID 545
mRNA Refseq NM_001184
Protein Refseq NP_001175
MIM 601215
UniProt ID Q13535

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATR Products

Required fields are marked with *

My Review for All ATR Products

Required fields are marked with *

0
cart-icon
0
compare icon