Recombinant Human ATXN7 protein, GST-tagged
Cat.No. : | ATXN7-301504H |
Product Overview : | Recombinant Human ATXN7 (170-335 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met170-Arg335 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MHSSSSKPPLAVPPTSVFSFFPSLSKSKGGSASGSNRSSSGGVLSASSSSSKLLKSPKEKLQLRGNTRPMHPIQQSRVPHGRIMTPSVKVEKIHPKMDGTLLKSAVGPTCPATVSSLVKPGLNCPSIPKPTLPSPGQILNGKGLPAPPTLEKKPEDNSNNRKFLNKR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ATXN7 ataxin 7 [ Homo sapiens ] |
Official Symbol | ATXN7 |
Synonyms | ATXN7; ataxin 7; SCA7, spinocerebellar ataxia 7 (olivopontocerebellar atrophy with retinal degeneration); ataxin-7; ADCAII; OPCA3; spinocerebellar ataxia type 7 protein; SCA7; FLJ17787; |
Gene ID | 6314 |
mRNA Refseq | NM_000333 |
Protein Refseq | NP_000324 |
MIM | 607640 |
UniProt ID | O15265 |
◆ Recombinant Proteins | ||
ATXN7-301504H | Recombinant Human ATXN7 protein, GST-tagged | +Inquiry |
ATXN7-2198M | Recombinant Mouse ATXN7 Protein | +Inquiry |
ATXN7-903M | Recombinant Mouse ATXN7 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATXN7-917H | Recombinant Human ATXN7 protein, His&Myc-tagged | +Inquiry |
ATXN7-3690H | Recombinant Human ATXN7, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATXN7 Products
Required fields are marked with *
My Review for All ATXN7 Products
Required fields are marked with *
0
Inquiry Basket