Recombinant Human ATXN7 protein, His&Myc-tagged
Cat.No. : | ATXN7-917H |
Product Overview : | Recombinant Human ATXN7 protein(O15265)(79-401aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 79-401aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.1 kDa |
AA Sequence : | GERRPLPSPEVMLGQSWNLWVEASKLPGKDGTELDESFKEFGKNREVMGLCREDMPIFGFCPAHDDFYLVVCNDCNQVVKPQAFQSHYERRHSSSSKPPLAVPPTSVFSFFPSLSKSKGGSASGSNRSSSGGVLSASSSSSKLLKSPKEKLQLRGNTRPMHPIQQSRVPHGRIMTPSVKVEKIHPKMDGTLLKSAVGPTCPATVSSLVKPGLNCPSIPKPTLPSPGQILNGKGLPAPPTLEKKPEDNSNNRKFLNKRLSEREFDPDIHCGVIDLDTKKPCTRSLTCKTHSLTQRRAVQGRRKRFDVLLAEHKNKTREKELIRH |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATXN7 ataxin 7 [ Homo sapiens ] |
Official Symbol | ATXN7 |
Synonyms | ATXN7; ataxin 7; SCA7, spinocerebellar ataxia 7 (olivopontocerebellar atrophy with retinal degeneration); ataxin-7; ADCAII; OPCA3; spinocerebellar ataxia type 7 protein; SCA7; FLJ17787; |
Gene ID | 6314 |
mRNA Refseq | NM_000333 |
Protein Refseq | NP_000324 |
MIM | 607640 |
UniProt ID | O15265 |
◆ Recombinant Proteins | ||
ATXN7-3690H | Recombinant Human ATXN7, His-tagged | +Inquiry |
ATXN7-903M | Recombinant Mouse ATXN7 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATXN7-2198M | Recombinant Mouse ATXN7 Protein | +Inquiry |
ATXN7-917H | Recombinant Human ATXN7 protein, His&Myc-tagged | +Inquiry |
ATXN7-301504H | Recombinant Human ATXN7 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATXN7 Products
Required fields are marked with *
My Review for All ATXN7 Products
Required fields are marked with *
0
Inquiry Basket