Recombinant Human AURKC protein, GST-tagged
Cat.No. : | AURKC-1039H |
Product Overview : | Human AURKC full-length ORF ( NP_001015878.1, 1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 62 kDa |
AA Sequence : | MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AURKC aurora kinase C [ Homo sapiens ] |
Official Symbol | AURKC |
Synonyms | AURKC; aurora kinase C; serine/threonine kinase 13 (aurora/IPL1 like) , STK13; ARK3; AurC; ARK-3; aurora 3; aurora-related kinase 3; aurora/IPL1/EG2 protein 2; aurora/IPL1-related kinase 3; serine/threonine-protein kinase 13; serine/threonine-protein kinase aurora-C; serine/threonine kinase 13 (aurora/IPL1-like); AIE2; AIK3; SPGF5; STK13; aurora-C; |
Gene ID | 6795 |
mRNA Refseq | NM_001015878 |
Protein Refseq | NP_001015878 |
MIM | 603495 |
UniProt ID | Q9UQB9 |
◆ Recombinant Proteins | ||
Aurkc-532R | Recombinant Rat Aurkc Protein, His-tagged | +Inquiry |
Aurkc-3782M | Recombinant Mouse Aurkc, His-tagged | +Inquiry |
AURKC-1114H | Recombinant Human AURKC Protein (S2-S309), Tag Free | +Inquiry |
AURKC-530H | Recombinant Human AURKC Protein, His-tagged | +Inquiry |
AURKC-248H | Recombinant Human Aurora Kinase C, GST-tagged, Active | +Inquiry |
◆ Cell & Tissue Lysates | ||
AURKC-8559HCL | Recombinant Human AURKC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AURKC Products
Required fields are marked with *
My Review for All AURKC Products
Required fields are marked with *
0
Inquiry Basket