Recombinant Human AURKC protein, GST-tagged

• Cat.No.: AURKC-1039H
• Product Overview: Human AURKC full-length ORF ( NP_001015878.1, 1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
• Molecular Mass: 62 kDa
• AA Sequence: MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AURKC aurora kinase C [ Homo sapiens ]
• Official Symbol: AURKC
• Synonyms: AURKC; aurora kinase C; serine/threonine kinase 13 (aurora/IPL1 like) , STK13; ARK3; AurC; ARK-3; aurora 3; aurora-related kinase 3; aurora/IPL1/EG2 protein 2; aurora/IPL1-related kinase 3; serine/threonine-protein kinase 13; serine/threonine-protein kinase aurora-C; serine/threonine kinase 13 (aurora/IPL1-like); AIE2; AIK3; SPGF5; STK13; aurora-C
• Gene ID: 6795
• mRNA Refseq: NM_001015878
• Protein Refseq: NP_001015878
• MIM: 603495
• UniProt ID: Q9UQB9