Recombinant Human AURKC protein, GST-tagged

Cat.No. : AURKC-1039H
Product Overview : Human AURKC full-length ORF ( NP_001015878.1, 1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Molecular Mass : 62 kDa
AA Sequence : MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AURKC aurora kinase C [ Homo sapiens ]
Official Symbol AURKC
Synonyms AURKC; aurora kinase C; serine/threonine kinase 13 (aurora/IPL1 like) , STK13; ARK3; AurC; ARK-3; aurora 3; aurora-related kinase 3; aurora/IPL1/EG2 protein 2; aurora/IPL1-related kinase 3; serine/threonine-protein kinase 13; serine/threonine-protein kinase aurora-C; serine/threonine kinase 13 (aurora/IPL1-like); AIE2; AIK3; SPGF5; STK13; aurora-C;
Gene ID 6795
mRNA Refseq NM_001015878
Protein Refseq NP_001015878
MIM 603495
UniProt ID Q9UQB9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AURKC Products

Required fields are marked with *

My Review for All AURKC Products

Required fields are marked with *

0
cart-icon
0
compare icon