Recombinant Human AXIN1, GST-tagged
Cat.No. : | AXIN1-105H |
Product Overview : | Recombinant Human AXIN1(1 a.a. - 589 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2, and itself. This protein functions as a negative regulator of the wingless-type MMTV integration site family, member 1 (WNT) signaling pathway and can induce apoptosis. The crystal structure of a portion of this protein, alone and in a complex with other proteins, has been resolved. Mutations in this gene have been associated with hepatocellular carcinoma, hepatoblastomas, ovarian endometriod adenocarcinomas, and medullablastomas. Two transcript variants encoding distinct isoforms have been identified for this gene. |
Molecular Mass : | 90.53 kDa |
AA Sequence : | MTGLLKRKFDQLDEDNSSVSSSSSSSGCQSRSCSPSSSVSRAWDSEEEGPWDQMPLPDRDFCGPRSFTPLSILKR ARRERPGRVAFDGITVFYFPRCQGFTSVPSRGGCTLGMALRHSACRRFSLAEFAQEQARARHEKLRQRLKEEKLE MLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVSFLQPYPARRRRALLRASGVRRIDREEKR ELQALRQSREDCGCHCDRICDPETCSCSLAGIKCQMDHTAFPCGCCREGCENPMGRVEFNQARVQTHFIHTLTRL QLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAKPPMNNELGDNSCSSDMTDSSTASSSASGTSEAPDCPTHP GLPGPGFQPGVDDDSLARILSFSDSDFGGEEEEEEEGSVGNLDNLSCFHPADIFGTSDPGGLASWTHSYSGCSFT SGILDENANLDASCFLNGGLEGSREGSLPGTSVPPSMDAGRSSSVDLSLSSCDSFELLQALPDYSLGPHYTSQKV SDSLDNIEAPHFPLPGLSPPGDASSCFLESLMGFSEPAAEALDPFIDSQFEDTVPASLMEPVPV |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AXIN1 axin 1 [ Homo sapiens (human) ] |
Official Symbol | AXIN1 |
Synonyms | AXIN1; axin 1; axin-1; PPP1R49; protein phosphatase 1; regulatory subunit 49; axis inhibitor 1; fused, mouse, homolog of; axis inhibition protein 1; protein phosphatase 1, regulatory subunit 49; AXIN; MGC52315 |
Gene ID | 8312 |
mRNA Refseq | NM_003502 |
Protein Refseq | NP_003493 |
MIM | 603816 |
UniProt ID | O15169 |
Chromosome Location | 16p13.3 |
Pathway | AMER1 mutants destabilize the destruction complex; APC truncation mutants have impaired AXIN binding; Basal cell carcinoma |
Function | GTPase activator activity; R-SMAD binding; armadillo repeat domain binding |
◆ Recombinant Proteins | ||
AXIN1-01H | Recombinant Human AXIN1 Protein | +Inquiry |
Axin1-3793M | Recombinant Mouse Axin1, His-tagged | +Inquiry |
AXIN1-13H | Recombinant Human axin 1 Protein, His tagged | +Inquiry |
AXIN1-26564TH | Recombinant Human AXIN1, His-tagged | +Inquiry |
AXIN1-9053Z | Recombinant Zebrafish AXIN1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AXIN1 Products
Required fields are marked with *
My Review for All AXIN1 Products
Required fields are marked with *
0
Inquiry Basket