Recombinant Human AXIN2 protein, GST-tagged
| Cat.No. : | AXIN2-10085H |
| Product Overview : | Recombinant Human AXIN2 protein(30-83 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 30-83 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | EGETPPCQPGVGKGQVTKPMPVSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | AXIN2 |
| Synonyms | AXIN2; axin 2; axin-2; axil; conductin; DKFZp781B0869; MGC126582; axin-like protein; axis inhibition protein 2; AXIL; MGC10366; |
| Gene ID | 8313 |
| mRNA Refseq | NM_004655 |
| Protein Refseq | NP_004646 |
| MIM | 604025 |
| UniProt ID | Q9Y2T1 |
| ◆ Recombinant Proteins | ||
| AXIN2-391H | Recombinant Human AXIN2 Protein, His-tagged | +Inquiry |
| AXIN2-910R | Recombinant Rat AXIN2 Protein | +Inquiry |
| AXIN2-1066HF | Recombinant Full Length Human AXIN2 Protein, GST-tagged | +Inquiry |
| AXIN2-6061C | Recombinant Chicken AXIN2 | +Inquiry |
| AXIN2-10085H | Recombinant Human AXIN2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AXIN2-8554HCL | Recombinant Human AXIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AXIN2 Products
Required fields are marked with *
My Review for All AXIN2 Products
Required fields are marked with *
