Recombinant Human B4GALNT1 protein, GST-tagged

Cat.No. : B4GALNT1-026H
Product Overview : Human B4GALNT1 full-length ORF ( AAH29828.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively. [provided by RefSeq]
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 61.9 kDa
AA Sequence : MWLGRRALCALVLLLACASLGLLYASTRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTGARPGWRDGQAGQTEKNQKGWSGQMAEGMGGIWAMARAVQPHNGCFNWTSRARGRKGAFVHLGLEQARGKPEPWVCLPFRPTVGGPRKRLV
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name B4GALNT1 beta-1,4-N-acetyl-galactosaminyl transferase 1 [ Homo sapiens ]
Official Symbol B4GALNT1
Synonyms B4GALNT1; beta-1,4-N-acetyl-galactosaminyl transferase 1; GALGT, UDP Gal:betaGlcNAc beta 1,4 N acetylgalactosaminyltransferase transferase 1 , UDP N acetyl alpha D galactosamine:(N acetylneuraminyl) galactosylglucosylceramide N acetylgalactosaminyltransferase (GalNAc T); beta-1,4 N-acetylgalactosaminyltransferase 1; beta1 4GalNAc T; GD2 synthase; GM2 synthase; GalNAc-T; beta1,4GalNAc-T; beta1-4GalNAc-T; GM2/GD2 synthase; GD2 synthase, GM2 synthase; (N-acetylneuraminyl)-galactosylglucosylceramide; UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1; UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase (GalNAc-T); GALGT; GALNACT;
Gene ID 2583
mRNA Refseq NM_001478
Protein Refseq NP_001469
MIM 601873
UniProt ID Q00973

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B4GALNT1 Products

Required fields are marked with *

My Review for All B4GALNT1 Products

Required fields are marked with *

0
cart-icon