Recombinant Human B4GALT4, His-tagged

Cat.No. : B4GALT4-27423TH
Product Overview : Recombinant fragment, corresponding to amino acids 25-344 of Human B4GALT4 with a N terminal His tag; predicted MWt 38 kDa:
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 25-344 a.a.
Description : This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene appears to mainly play a role in glycolipid biosynthesis. Two alternatively spliced transcript variants have been found for this gene.
Conjugation : HIS
Form : Lyophilised:reconstitution with 73 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLT NEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQ AENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYL LEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLE ALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVG RNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGW GGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYI NITVDFWFGA
Gene Name B4GALT4 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 [ Homo sapiens ]
Official Symbol B4GALT4
Synonyms B4GALT4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4; beta-1,4-galactosyltransferase 4; beta4Gal T4;
Gene ID 8702
mRNA Refseq NM_003778
Protein Refseq NP_003769
MIM 604015
Uniprot ID O60513
Chromosome Location 3q13.3
Pathway Asparagine N-linked glycosylation, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, conserved biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, organism-specific biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, conserved biosystem;
Function N-acetyllactosamine synthase activity; galactosyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B4GALT4 Products

Required fields are marked with *

My Review for All B4GALT4 Products

Required fields are marked with *

0
cart-icon