Recombinant Human B4GALT4, His-tagged
Cat.No. : | B4GALT4-27423TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 25-344 of Human B4GALT4 with a N terminal His tag; predicted MWt 38 kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-344 a.a. |
Description : | This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene appears to mainly play a role in glycolipid biosynthesis. Two alternatively spliced transcript variants have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 73 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLT NEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQ AENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYL LEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLE ALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVG RNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGW GGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYI NITVDFWFGA |
Gene Name | B4GALT4 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 [ Homo sapiens ] |
Official Symbol | B4GALT4 |
Synonyms | B4GALT4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4; beta-1,4-galactosyltransferase 4; beta4Gal T4; |
Gene ID | 8702 |
mRNA Refseq | NM_003778 |
Protein Refseq | NP_003769 |
MIM | 604015 |
Uniprot ID | O60513 |
Chromosome Location | 3q13.3 |
Pathway | Asparagine N-linked glycosylation, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, conserved biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, organism-specific biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, conserved biosystem; |
Function | N-acetyllactosamine synthase activity; galactosyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups; |
◆ Recombinant Proteins | ||
B4GALT4-325R | Recombinant Rhesus Macaque B4GALT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
B4galt4-06HCL | Recombinant Mouse B4galt4 overexpression lysate | +Inquiry |
B4GALT4-0250H | Recombinant Human B4GALT4 Protein (Gln39-Ala344), C-His-tagged | +Inquiry |
RFL30509HF | Recombinant Full Length Human Beta-1,4-Galactosyltransferase 4(B4Galt4) Protein, His-Tagged | +Inquiry |
B4GALT4-2643H | Recombinant Human B4GALT4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
B4GALT4-8537HCL | Recombinant Human B4GALT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B4GALT4 Products
Required fields are marked with *
My Review for All B4GALT4 Products
Required fields are marked with *
0
Inquiry Basket