Recombinant Human B9D2 protein, GST-tagged

Cat.No. : B9D2-039H
Product Overview : Human B9D2 full-length ORF ( NP_085055.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 45.7 kDa
AA Sequence : MAEVHVIGQIMGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name B9D2 B9 protein domain 2 [ Homo sapiens ]
Official Symbol B9D2
Synonyms B9D2; B9 protein domain 2; B9 domain-containing protein 2; MGC4093; MKS1-related protein 2; involved in cIlia stability-1; MKS10; MKSR2; ICIS-1;
Gene ID 80776
mRNA Refseq NM_030578
Protein Refseq NP_085055
MIM 611951
UniProt ID Q9BPU9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B9D2 Products

Required fields are marked with *

My Review for All B9D2 Products

Required fields are marked with *

0
cart-icon