Recombinant Human B9D2 protein, GST-tagged
| Cat.No. : | B9D2-039H |
| Product Overview : | Human B9D2 full-length ORF ( NP_085055.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 45.7 kDa |
| AA Sequence : | MAEVHVIGQIMGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | B9D2 B9 protein domain 2 [ Homo sapiens ] |
| Official Symbol | B9D2 |
| Synonyms | B9D2; B9 protein domain 2; B9 domain-containing protein 2; MGC4093; MKS1-related protein 2; involved in cIlia stability-1; MKS10; MKSR2; ICIS-1; |
| Gene ID | 80776 |
| mRNA Refseq | NM_030578 |
| Protein Refseq | NP_085055 |
| MIM | 611951 |
| UniProt ID | Q9BPU9 |
| ◆ Recombinant Proteins | ||
| B9D2-4771H | Recombinant Human B9D2 protein, GST-tagged | +Inquiry |
| B9D2-1749HF | Recombinant Full Length Human B9D2 Protein, GST-tagged | +Inquiry |
| B9D2-583R | Recombinant Rat B9D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| B9D2-039H | Recombinant Human B9D2 protein, GST-tagged | +Inquiry |
| B9D2-329R | Recombinant Rhesus Macaque B9D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| B9D2-8535HCL | Recombinant Human B9D2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B9D2 Products
Required fields are marked with *
My Review for All B9D2 Products
Required fields are marked with *
