Recombinant Human BAAT protein, GST-tagged
Cat.No. : | BAAT-042H |
Product Overview : | Human BAAT partial ORF ( NP_001692, 258 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BAAT bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase) [ Homo sapiens ] |
Official Symbol | BAAT |
Synonyms | BAAT; bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase); bile acid Coenzyme A: amino acid N acyltransferase (glycine N choloyltransferase); bile acid-CoA:amino acid N-acyltransferase; BAT; long-chain fatty-acyl-CoA hydrolase; bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase); BACAT; FLJ20300; MGC104432; |
Gene ID | 570 |
mRNA Refseq | NM_001127610 |
Protein Refseq | NP_001121082 |
MIM | 602938 |
UniProt ID | Q14032 |
◆ Recombinant Proteins | ||
BAAT-042H | Recombinant Human BAAT protein, GST-tagged | +Inquiry |
BAAT-10119H | Recombinant Human BAAT, GST-tagged | +Inquiry |
Baat-686M | Recombinant Mouse Baat Protein, MYC/DDK-tagged | +Inquiry |
BAAT-585R | Recombinant Rat BAAT Protein, His (Fc)-Avi-tagged | +Inquiry |
BAAT-1425H | Recombinant Human BAAT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAAT-8533HCL | Recombinant Human BAAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAAT Products
Required fields are marked with *
My Review for All BAAT Products
Required fields are marked with *
0
Inquiry Basket