Recombinant Human BAAT protein, GST-tagged
| Cat.No. : | BAAT-042H |
| Product Overview : | Human BAAT partial ORF ( NP_001692, 258 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BAAT bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase) [ Homo sapiens ] |
| Official Symbol | BAAT |
| Synonyms | BAAT; bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase); bile acid Coenzyme A: amino acid N acyltransferase (glycine N choloyltransferase); bile acid-CoA:amino acid N-acyltransferase; BAT; long-chain fatty-acyl-CoA hydrolase; bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase); BACAT; FLJ20300; MGC104432; |
| Gene ID | 570 |
| mRNA Refseq | NM_001127610 |
| Protein Refseq | NP_001121082 |
| MIM | 602938 |
| UniProt ID | Q14032 |
| ◆ Recombinant Proteins | ||
| BAAT-585R | Recombinant Rat BAAT Protein, His (Fc)-Avi-tagged | +Inquiry |
| BAAT-042H | Recombinant Human BAAT protein, GST-tagged | +Inquiry |
| BAAT-1425H | Recombinant Human BAAT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BAAT-2262M | Recombinant Mouse BAAT Protein | +Inquiry |
| BAAT-927R | Recombinant Rat BAAT Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BAAT-8533HCL | Recombinant Human BAAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAAT Products
Required fields are marked with *
My Review for All BAAT Products
Required fields are marked with *




