Recombinant Human BAP1 Protein, His-tagged

Cat.No. : BAP1-12H
Product Overview : Recombinant Human BAP1 Protein(575-729 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 575-729 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : LTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol BAP1
Synonyms BAP1; BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase); ubiquitin carboxyl-terminal hydrolase BAP1; hucep 6; KIAA0272; UCHL2; cerebral protein 6; cerebral protein-13; TPDS; hucep-6; HUCEP-13; FLJ35406; FLJ37180; DKFZp686N04275;
Gene ID 8314
mRNA Refseq NM_004656
Protein Refseq NP_004647
MIM 603089
UniProt ID Q92560

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BAP1 Products

Required fields are marked with *

My Review for All BAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon