Recombinant Human BATF Protein, GST-tagged
| Cat.No. : | BATF-092H |
| Product Overview : | Human BATF full-length ORF ( NP_006390.1, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 40.5 kDa |
| AA Sequence : | MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BATF basic leucine zipper transcription factor, ATF-like [ Homo sapiens ] |
| Official Symbol | BATF |
| Synonyms | BATF; basic leucine zipper transcription factor, ATF-like; basic leucine zipper transcriptional factor ATF-like; activating transcription factor B; B ATF; BATF1; SF HT activated gene 2; SFA 2; SF-HT-activated gene 2 protein; B-cell-activating transcription factor; SFA2; B-ATF; SFA-2; |
| Gene ID | 10538 |
| mRNA Refseq | NM_006399 |
| Protein Refseq | NP_006390 |
| MIM | 612476 |
| UniProt ID | Q16520 |
| ◆ Recombinant Proteins | ||
| BATF-4118Z | Recombinant Zebrafish BATF | +Inquiry |
| BATF-944R | Recombinant Rat BATF Protein | +Inquiry |
| BATF-093H | Recombinant Human BATF Protein, GST-tagged | +Inquiry |
| BATF-5417H | Recombinant Human BATF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BATF-092H | Recombinant Human BATF Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BATF-155HCL | Recombinant Human BATF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BATF Products
Required fields are marked with *
My Review for All BATF Products
Required fields are marked with *



