Recombinant Human BAX, His-tagged
| Cat.No. : | BAX-6976H |
| Product Overview : | Recombinant Human Apoptosis Regulator BAX/BAX is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Gln171) of Human BAX fused with a 6His tag at both the N-terminus and C-terminus. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Citation
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Met1-Gln171 |
| Form : | Lyophilized from sterile 20mM PB,150mM NaCl, 2mM EDTA, 5% Threhalose, pH7.4. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH |
| Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method. |
| Purity : | >95% as determined by SDS-PAGE. |
| Stability : | Samples are stable for up to twelve months from date of receipt at -70ºC. |
| Storage : | Store it under sterile conditions at -20ºC~-70ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents. |
| Publications : |
Does VDAC2 Have A BH3 Domain? (2023)
Is VDAC1 a Novel BCL2 Family Member that Binds BAX? (2023)
Development of novel cytoprotective small compounds inhibiting mitochondria-dependent cell death (2023)
|
| Gene Name | BAX BCL2-associated X protein [ Homo sapiens ] |
| Official Symbol | BAX |
| Synonyms | BAX; BCL2-associated X protein; apoptosis regulator BAX; BCL2L4; bcl2-L-4; bcl-2-like protein 4; BCL2-associated X protein omega; |
| Gene ID | 581 |
| mRNA Refseq | NM_004324 |
| Protein Refseq | NP_004315 |
| MIM | 600040 |
| UniProt ID | Q07812 |
| ◆ Recombinant Proteins | ||
| BAX-2531H | Recombinant Human BAX Protein, His (Fc)-Avi-tagged | +Inquiry |
| BAX-1578HF | Recombinant Full Length Human BAX Protein, GST-tagged | +Inquiry |
| BAX-342R | Recombinant Rhesus Macaque BAX Protein, His (Fc)-Avi-tagged | +Inquiry |
| BAX-095H | Recombinant Human BAX Protein, GST-tagged | +Inquiry |
| BAX-2780H | Recombinant Human BAX Protein, His-tagged, OVA Conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BAX-8506HCL | Recombinant Human BAX 293 Cell Lysate | +Inquiry |
Development of novel cytoprotective small compounds inhibiting mitochondria-dependent apoptosis
Journal: bioRxiv Data: 2022/10/12
Authors: Matsuyama Mieko, Ortega Joseph, Matsuyama Shigemi
Article Snippet:PrePrint: DMEM (Catalog Number 11995, ThermoFisher) Fetal Calf Serum (FCS, Catalog Number 12999102, Fisher Scientific) Doxycycline Hyclate (Catalog Number 33429-100MG-R, SigmaAldrich) Puromycin (Catalog Number, DSP33020-0.025, Dot scientific inc) Geneticin (G418) (Catalog Number,10131027, ThermoFisher Scientific) Penicillin/Streptomycin (Catalog Number, SV30010, Fisher) (2-Hydroxypropyl)-beta-cyclodexitrin (bCD) (332607, Sigma-Aldrich), ABT-737 (Sellekchem., Catalog No. S1002) Obatoclax (Cayman Chemical Catalog No. 11499) Staurosporine (Sigma-Aldrich Catalogue No. S6942) BAM7 (Tocrs, Catalog No. 4810/10) Dexamethasone (Sigma-Aldrich, D4902) 15-Beta cyclodextrin, Sigma-Aldrich, Cat No. 332607.No. S6942) BAM7 (Tocrs, Catalog No. 4810/10) Dexamethasone (Sigma-Aldrich, D4902) 15-Beta cyclodextrin, Sigma-Aldrich, Cat No. 332607. ... His-tagged recombinant Bax protein Creative BioMart (Catalog No. BAX-6976H, Seattle, WA). anti-Bax polyclonal antibody (50599-2-IG, ProteinTech, 1:5000) Agarose beads conjugated with anti-Bax monoclonal antibody (clone 6A7) (Santa Cruz, Catalogue No. sc-23959AC) anti-Bak (sc-832, Santa Cruz, 1:200) anti-Bcl-2 (sc-7382, Santa Cruz, 1:500) anti-Bcl-XL(sc-1690, Santa Cruz, 1:500) anti-Mcl-1 (ab25955, Abcam, 1:1000) anti-Caspase-3 (9662s, Cell Signaling, 1:1000) anti-beta actin (A5441, Sigma-Aldrich, 1:20,000), Anti-rabbit IgG-HRP (R1006, Kindle Bioscience, 1:1000) Anti-mouse IgG-HRP (R1005, Kindle Biosciences, 1:1000) CSMs (M5(R and S), M6(R and S), M7, M11, M41S, and M109S were synthesized by Wuxi AppTek (HongKong))
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAX Products
Required fields are marked with *
My Review for All BAX Products
Required fields are marked with *
