Recombinant Human BAX, His-tagged

Cat.No. : BAX-6976H
Product Overview : Recombinant Human Apoptosis Regulator BAX/BAX is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Gln171) of Human BAX fused with a 6His tag at both the N-terminus and C-terminus.
Availability October 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Met1-Gln171
Form : Lyophilized from sterile 20mM PB,150mM NaCl, 2mM EDTA, 5% Threhalose, pH7.4.
AA Sequence : MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH
Endotoxin : < 1.0 EU per μg of the protein as determined by the LAL method.
Purity : >95% as determined by SDS-PAGE.
Stability : Samples are stable for up to twelve months from date of receipt at -70ºC.
Storage : Store it under sterile conditions at -20ºC~-70ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents.
Publications :
Does VDAC2 Have A BH3 Domain? (2023)
Is VDAC1 a Novel BCL2 Family Member that Binds BAX? (2023)
Development of novel cytoprotective small compounds inhibiting mitochondria-dependent cell death (2023)
Gene Name BAX BCL2-associated X protein [ Homo sapiens ]
Official Symbol BAX
Synonyms BAX; BCL2-associated X protein; apoptosis regulator BAX; BCL2L4; bcl2-L-4; bcl-2-like protein 4; BCL2-associated X protein omega;
Gene ID 581
mRNA Refseq NM_004324
Protein Refseq NP_004315
MIM 600040
UniProt ID Q07812

Development of novel cytoprotective small compounds inhibiting mitochondria-dependent apoptosis

Journal: bioRxiv    Data: 2022/10/12

Authors: Matsuyama Mieko, Ortega Joseph, Matsuyama Shigemi

Article Snippet:PrePrint: DMEM (Catalog Number 11995, ThermoFisher) Fetal Calf Serum (FCS, Catalog Number 12999102, Fisher Scientific) Doxycycline Hyclate (Catalog Number 33429-100MG-R, SigmaAldrich) Puromycin (Catalog Number, DSP33020-0.025, Dot scientific inc) Geneticin (G418) (Catalog Number,10131027, ThermoFisher Scientific) Penicillin/Streptomycin (Catalog Number, SV30010, Fisher) (2-Hydroxypropyl)-beta-cyclodexitrin (bCD) (332607, Sigma-Aldrich), ABT-737 (Sellekchem., Catalog No. S1002) Obatoclax (Cayman Chemical Catalog No. 11499) Staurosporine (Sigma-Aldrich Catalogue No. S6942) BAM7 (Tocrs, Catalog No. 4810/10) Dexamethasone (Sigma-Aldrich, D4902) 15-Beta cyclodextrin, Sigma-Aldrich, Cat No. 332607.No. S6942) BAM7 (Tocrs, Catalog No. 4810/10) Dexamethasone (Sigma-Aldrich, D4902) 15-Beta cyclodextrin, Sigma-Aldrich, Cat No. 332607. ... His-tagged recombinant Bax protein Creative BioMart (Catalog No. BAX-6976H, Seattle, WA). anti-Bax polyclonal antibody (50599-2-IG, ProteinTech, 1:5000) Agarose beads conjugated with anti-Bax monoclonal antibody (clone 6A7) (Santa Cruz, Catalogue No. sc-23959AC) anti-Bak (sc-832, Santa Cruz, 1:200) anti-Bcl-2 (sc-7382, Santa Cruz, 1:500) anti-Bcl-XL(sc-1690, Santa Cruz, 1:500) anti-Mcl-1 (ab25955, Abcam, 1:1000) anti-Caspase-3 (9662s, Cell Signaling, 1:1000) anti-beta actin (A5441, Sigma-Aldrich, 1:20,000), Anti-rabbit IgG-HRP (R1006, Kindle Bioscience, 1:1000) Anti-mouse IgG-HRP (R1005, Kindle Biosciences, 1:1000) CSMs (M5(R and S), M6(R and S), M7, M11, M41S, and M109S were synthesized by Wuxi AppTek (HongKong))

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BAX Products

Required fields are marked with *

My Review for All BAX Products

Required fields are marked with *

0
cart-icon
0
compare icon