Recombinant Human BAX, His-tagged

Cat.No. : BAX-6976H
Product Overview : Recombinant Human Apoptosis Regulator BAX/BAX is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Gln171) of Human BAX fused with a 6His tag at both the N-terminus and C-terminus.
Availability April 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Met1-Gln171
Form : Lyophilized from sterile 20mM PB,150mM NaCl, 2mM EDTA, 5% Threhalose, pH7.4.
AA Sequence : MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH
Endotoxin : < 1.0 EU per μg of the protein as determined by the LAL method.
Purity : >95% as determined by SDS-PAGE.
Stability : Samples are stable for up to twelve months from date of receipt at -70ºC.
Storage : Store it under sterile conditions at -20ºC~-70ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents.
Publications :
Does VDAC2 Have A BH3 Domain? (2023)
Is VDAC1 a Novel BCL2 Family Member that Binds BAX? (2023)
Development of novel cytoprotective small compounds inhibiting mitochondria-dependent cell death (2023)
Gene Name BAX BCL2-associated X protein [ Homo sapiens ]
Official Symbol BAX
Synonyms BAX; BCL2-associated X protein; apoptosis regulator BAX; BCL2L4; bcl2-L-4; bcl-2-like protein 4; BCL2-associated X protein omega;
Gene ID 581
mRNA Refseq NM_004324
Protein Refseq NP_004315
MIM 600040
UniProt ID Q07812

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BAX Products

Required fields are marked with *

My Review for All BAX Products

Required fields are marked with *

0

Inquiry Basket

cartIcon