Recombinant Human BBOX1 Protein, GST-tagged
| Cat.No. : | BBOX1-101H |
| Product Overview : | Human BBOX1 full-length ORF ( AAH11034, 1 a.a. - 387 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes gamma butyrobetaine hydroxylase which catalyzes the formation of L-carnitine from gamma-butyrobetaine, the last step in the L-carnitine biosynthetic pathway. Carnitine is essential for the transport of activated fatty acids across the mitochondrial membrane during mitochondrial beta-oxidation. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 68.31 kDa |
| AA Sequence : | MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BBOX1 butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1 [ Homo sapiens ] |
| Official Symbol | BBOX1 |
| Synonyms | BBOX1; butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1; BBOX; gamma-butyrobetaine dioxygenase; BBH; G BBH; gamma BBH; gamma-butyrobetaine hydroxylase; gamma-butyrobetaine,2-oxoglutarate dioxygenase 1; G-BBH; gamma-BBH; |
| Gene ID | 8424 |
| mRNA Refseq | NM_003986 |
| Protein Refseq | NP_003977 |
| MIM | 603312 |
| UniProt ID | O75936 |
| ◆ Recombinant Proteins | ||
| BBOX1-2474Z | Recombinant Zebrafish BBOX1 | +Inquiry |
| BBOX1-947R | Recombinant Rat BBOX1 Protein | +Inquiry |
| BBOX1-1049H | Recombinant Human BBOX1 protein(1-387aa), His&Myc-tagged | +Inquiry |
| BBOX1-10149H | Recombinant Human BBOX1, His-tagged | +Inquiry |
| BBOX1-101H | Recombinant Human BBOX1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BBOX1-001HCL | Recombinant Human BBOX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BBOX1 Products
Required fields are marked with *
My Review for All BBOX1 Products
Required fields are marked with *



