Recombinant Human BBS1 Protein
Cat.No. : | BBS1-105H |
Product Overview : | Human BBS1 partial ORF ( NP_078925, 187 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 187-295 a.a. |
Description : | Mutations in this gene have been observed in patients with the major form (type 1) of Bardet-Biedl syndrome. The encoded protein may play a role in eye, limb, cardiac and reproductive system development. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | NQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGL |
Purity : | Glutathione Sepharose 4 Fast Flow |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BBS1 Bardet-Biedl syndrome 1 [ Homo sapiens ] |
Official Symbol | BBS1 |
Synonyms | BBS1; Bardet-Biedl syndrome 1; Bardet-Biedl syndrome 1 protein; FLJ23590; BBS2-like protein 2; BBS2L2; MGC51114; MGC126183; MGC126184; |
Gene ID | 582 |
mRNA Refseq | NM_024649 |
Protein Refseq | NP_078925 |
MIM | 209901 |
UniProt ID | Q8NFJ9 |
◆ Recombinant Proteins | ||
BBS1-1583HF | Recombinant Full Length Human BBS1 Protein | +Inquiry |
BBS1-5671Z | Recombinant Zebrafish BBS1 | +Inquiry |
BBS1-105H | Recombinant Human BBS1 Protein | +Inquiry |
BBS1-02HFL | Recombinant Full Length Human BBS1 Protein, Tag Free | +Inquiry |
BBS1-104H | Recombinant Human BBS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BBS1-8504HCL | Recombinant Human BBS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BBS1 Products
Required fields are marked with *
My Review for All BBS1 Products
Required fields are marked with *
0
Inquiry Basket