Recombinant Human BBS7 Protein, GST-tagged
| Cat.No. : | BBS7-111H |
| Product Overview : | Human BBS7 partial ORF ( NP_060660, 574 a.a. - 672 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Mutations in this gene have been observed in patients with Bardet-Biedl syndrome type 7. The encoded protein may play a role in eye, limb, cardiac and reproductive system development. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | SILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYG |
| Purity : | Glutathione Sepharose 4 Fast Flow |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BBS7 Bardet-Biedl syndrome 7 [ Homo sapiens ] |
| Official Symbol | BBS7 |
| Synonyms | BBS7; Bardet-Biedl syndrome 7; Bardet-Biedl syndrome 7 protein; BBS2L1; FLJ10715; BBS2-like 1; BBS2-like protein 1; |
| Gene ID | 55212 |
| mRNA Refseq | NM_018190 |
| Protein Refseq | NP_060660 |
| MIM | 607590 |
| UniProt ID | Q8IWZ6 |
| ◆ Recombinant Proteins | ||
| BBS7-4606Z | Recombinant Zebrafish BBS7 | +Inquiry |
| BBS7-2377H | Recombinant Human BBS7 Protein, MYC/DDK-tagged | +Inquiry |
| BBS7-111H | Recombinant Human BBS7 Protein, GST-tagged | +Inquiry |
| Bbs7-1829M | Recombinant Mouse Bbs7 Protein, Myc/DDK-tagged | +Inquiry |
| BBS7-110H | Recombinant Human BBS7 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BBS7-158HCL | Recombinant Human BBS7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BBS7 Products
Required fields are marked with *
My Review for All BBS7 Products
Required fields are marked with *
