Recombinant Human BCAM protein, GST-tagged
Cat.No. : | BCAM-301325H |
Product Overview : | Recombinant Human BCAM (569-628 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Tyr569-Cys628 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | YCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | BCAM basal cell adhesion molecule (Lutheran blood group) [ Homo sapiens ] |
Official Symbol | BCAM |
Synonyms | BCAM; basal cell adhesion molecule (Lutheran blood group); basal cell adhesion molecule (Lu and Au blood groups) , LU, Lutheran blood group (Auberger b antigen included); basal cell adhesion molecule; CD239; F8/G253 antigen; lutheran antigen; Auberger b antigen; glycoprotein 95kDa; B-cell adhesion molecule; B-CAM cell surface glycoprotein; lutheran blood group glycoprotein; antigen identified by monoclonal F8; basal cell adhesion molecule (Lu and Au blood groups); AU; LU; MSK19; |
Gene ID | 4059 |
mRNA Refseq | NM_001013257 |
Protein Refseq | NP_001013275 |
MIM | 612773 |
UniProt ID | P50895 |
◆ Recombinant Proteins | ||
BCAM-113H | Recombinant Human BCAM Protein, GST-tagged | +Inquiry |
BCAM-1553C | Recombinant Cynomolgus BCAM protein, His-tagged | +Inquiry |
BCAM-4517Z | Recombinant Zebrafish BCAM | +Inquiry |
BCAM-595H | Recombinant Human BCAM protein, hFc-tagged | +Inquiry |
BCAM-4469H | Recombinant Human BCAM Protein (Met1-Ala547), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAM-1708MCL | Recombinant Mouse BCAM cell lysate | +Inquiry |
BCAM-1438RCL | Recombinant Rat BCAM cell lysate | +Inquiry |
BCAM-1649HCL | Recombinant Human BCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAM Products
Required fields are marked with *
My Review for All BCAM Products
Required fields are marked with *