Recombinant Human BCAM protein, GST-tagged

Cat.No. : BCAM-301325H
Product Overview : Recombinant Human BCAM (569-628 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Tyr569-Cys628
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : YCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name BCAM basal cell adhesion molecule (Lutheran blood group) [ Homo sapiens ]
Official Symbol BCAM
Synonyms BCAM; basal cell adhesion molecule (Lutheran blood group); basal cell adhesion molecule (Lu and Au blood groups) , LU, Lutheran blood group (Auberger b antigen included); basal cell adhesion molecule; CD239; F8/G253 antigen; lutheran antigen; Auberger b antigen; glycoprotein 95kDa; B-cell adhesion molecule; B-CAM cell surface glycoprotein; lutheran blood group glycoprotein; antigen identified by monoclonal F8; basal cell adhesion molecule (Lu and Au blood groups); AU; LU; MSK19;
Gene ID 4059
mRNA Refseq NM_001013257
Protein Refseq NP_001013275
MIM 612773
UniProt ID P50895

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCAM Products

Required fields are marked with *

My Review for All BCAM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon