Recombinant Human BCAM protein, GST-tagged
| Cat.No. : | BCAM-301325H |
| Product Overview : | Recombinant Human BCAM (569-628 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Tyr569-Cys628 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | YCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | BCAM basal cell adhesion molecule (Lutheran blood group) [ Homo sapiens ] |
| Official Symbol | BCAM |
| Synonyms | BCAM; basal cell adhesion molecule (Lutheran blood group); basal cell adhesion molecule (Lu and Au blood groups) , LU, Lutheran blood group (Auberger b antigen included); basal cell adhesion molecule; CD239; F8/G253 antigen; lutheran antigen; Auberger b antigen; glycoprotein 95kDa; B-cell adhesion molecule; B-CAM cell surface glycoprotein; lutheran blood group glycoprotein; antigen identified by monoclonal F8; basal cell adhesion molecule (Lu and Au blood groups); AU; LU; MSK19; |
| Gene ID | 4059 |
| mRNA Refseq | NM_001013257 |
| Protein Refseq | NP_001013275 |
| MIM | 612773 |
| UniProt ID | P50895 |
| ◆ Recombinant Proteins | ||
| BCAM-607R | Recombinant Rat BCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
| BCAM-168H | Recombinant Human BCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
| BCAM-301325H | Recombinant Human BCAM protein, GST-tagged | +Inquiry |
| BCAM-113H | Recombinant Human BCAM Protein, GST-tagged | +Inquiry |
| BCAM-2369H | Recombinant Human BCAM Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCAM-1708MCL | Recombinant Mouse BCAM cell lysate | +Inquiry |
| BCAM-1649HCL | Recombinant Human BCAM cell lysate | +Inquiry |
| BCAM-1438RCL | Recombinant Rat BCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAM Products
Required fields are marked with *
My Review for All BCAM Products
Required fields are marked with *



