Recombinant Human BCAP31 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : BCAP31-1674H
Product Overview : BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_005736) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16.
Molecular Mass : 28 kDa
AA Sequence : MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIREYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BCAP31 B-cell receptor-associated protein 31 [ Homo sapiens (human) ]
Official Symbol BCAP31
Synonyms BCAP31; B-cell receptor-associated protein 31; 6C6 Ag; BAP31; CDM; DXS1357E; p28 Bap31; BCR-associated protein Bap31; 6C6-AG tumor-associated antigen; 6C6-AG;
Gene ID 10134
mRNA Refseq NM_005745
Protein Refseq NP_005736
MIM 300398
UniProt ID P51572

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCAP31 Products

Required fields are marked with *

My Review for All BCAP31 Products

Required fields are marked with *

0
cart-icon
0
compare icon