Recombinant Human BCAP31 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BCAP31-5103H |
Product Overview : | BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132929) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16. |
Molecular Mass : | 34.6 kDa |
AA Sequence : | MGAEASSSWCPGTALPEERLSVKRASEISGFLGQGSSGEAALDVLTHVLEGAGNKLTSSCGKPSSNRMSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BCAP31 B-cell receptor-associated protein 31 [ Homo sapiens (human) ] |
Official Symbol | BCAP31 |
Synonyms | BCAP31; B-cell receptor-associated protein 31; 6C6 Ag; BAP31; CDM; DXS1357E; p28 Bap31; BCR-associated protein Bap31; 6C6-AG tumor-associated antigen; 6C6-AG; |
Gene ID | 10134 |
mRNA Refseq | NM_001139457 |
Protein Refseq | NP_001132929 |
MIM | 300398 |
UniProt ID | P51572 |
◆ Recombinant Proteins | ||
BCAP31-2320M | Recombinant Mouse BCAP31 Protein | +Inquiry |
BCAP31-429H | Recombinant Human BCAP31 Protein, His (Fc)-Avi-tagged | +Inquiry |
BCAP31-1947HFL | Recombinant Full Length Human BCAP31 Protein, C-Flag-tagged | +Inquiry |
BCAP31-1597HF | Recombinant Full Length Human BCAP31 Protein, GST-tagged | +Inquiry |
BCAP31-5197H | Recombinant Human BCAP31 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAP31-8499HCL | Recombinant Human BCAP31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAP31 Products
Required fields are marked with *
My Review for All BCAP31 Products
Required fields are marked with *