Recombinant Human BCAS1 Protein, GST-tagged
Cat.No. : | BCAS1-124H |
Product Overview : | Human BCAS1 partial ORF ( NP_003648, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 34.54 kDa |
AA Sequence : | MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEISAVADANGKNL |
Purity : | Glutathione Sepharose 4 Fast Flow |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCAS1 breast carcinoma amplified sequence 1 [ Homo sapiens ] |
Official Symbol | BCAS1 |
Synonyms | BCAS1; breast carcinoma amplified sequence 1; breast carcinoma-amplified sequence 1; AIBC1; NABC1; novel amplified in breast cancer 1; amplified and overexpressed in breast cancer; |
Gene ID | 8537 |
mRNA Refseq | NM_003657 |
Protein Refseq | NP_003648 |
MIM | 602968 |
UniProt ID | O75363 |
◆ Recombinant Proteins | ||
BCAS1-2368H | Recombinant Human BCAS1 Protein, MYC/DDK-tagged | +Inquiry |
BCAS1-1340H | Recombinant Human BCAS1 Protein (1-584 aa), His-tagged | +Inquiry |
BCAS1-124H | Recombinant Human BCAS1 Protein, GST-tagged | +Inquiry |
BCAS1-1601HF | Recombinant Full Length Human BCAS1 Protein, GST-tagged | +Inquiry |
Bcas1-1842M | Recombinant Mouse Bcas1 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAS1 Products
Required fields are marked with *
My Review for All BCAS1 Products
Required fields are marked with *