Recombinant Human BCAS2 protein, GST-tagged

• Cat.No.: BCAS2-2576H
• Product Overview: Recombinant Human BCAS2 protein(O75934)(1-225aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-225aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 53 kDa
• AA Sequence: AGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: BCAS2 breast carcinoma amplified sequence 2 [ Homo sapiens ]
• Official Symbol: BCAS2
• Synonyms: BCAS2; breast carcinoma amplified sequence 2; pre-mRNA-splicing factor SPF27; DAM1; Snt309; SPF27; breast carcinoma-amplified sequence 2; spliceosome-associated protein SPF 27; DNA amplified in mammary carcinoma 1 protein; spliceosome associated protein, amplified in breast cancer
• Gene ID: 10286
• mRNA Refseq: NM_005872
• Protein Refseq: NP_005863
• MIM: 605783
• UniProt ID: O75934