Recombinant Human BCDIN3D Protein, GST-tagged
Cat.No. : | BCDIN3D-133H |
Product Overview : | Human BCDIN3D full-length ORF ( NP_859059.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 59.6 kDa |
AA Sequence : | MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCDIN3D BCDIN3 domain containing [ Homo sapiens ] |
Official Symbol | BCDIN3D |
Gene ID | 144233 |
mRNA Refseq | NM_181708.2 |
Protein Refseq | NP_859059.1 |
UniProt ID | Q7Z5W3 |
◆ Recombinant Proteins | ||
BCDIN3D-983M | Recombinant Mouse BCDIN3D Protein, His (Fc)-Avi-tagged | +Inquiry |
BCDIN3D-953R | Recombinant Rat BCDIN3D Protein | +Inquiry |
BCDIN3D-3359H | Recombinant Human BCDIN3D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BCDIN3D-611R | Recombinant Rat BCDIN3D Protein, His (Fc)-Avi-tagged | +Inquiry |
BCDIN3D-133H | Recombinant Human BCDIN3D Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCDIN3D-8494HCL | Recombinant Human BCDIN3D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCDIN3D Products
Required fields are marked with *
My Review for All BCDIN3D Products
Required fields are marked with *