Recombinant Human BCL11A

Cat.No. : BCL11A-28026TH
Product Overview : Recombinant fragment of Human Ctip1 (amino acids 1-88) with proprietary tag at N-terminal,.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 88 amino acids
Description : This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene.
Molecular Weight : 35.310kDa inclusive of tags
Tissue specificity : Expressed at high levels in brain, spleen thymus, bone marrow and testis. Expressed in CD34-positive myeloid precursor cells, B-cells, monocytes and megakaryocytes. Expression is tightly regulated during B-cell development.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
Sequence Similarities : Contains 6 C2H2-type zinc fingers.
Gene Name BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) [ Homo sapiens ]
Official Symbol BCL11A
Synonyms BCL11A; B-cell CLL/lymphoma 11A (zinc finger protein); ecotropic viral integration site 9 , EVI9; B-cell lymphoma/leukemia 11A; BCL11A L; BCL11A S; BCL11A XL; CTIP1; HBFQTL5; ZNF856;
Gene ID 53335
mRNA Refseq NM_018014
Protein Refseq NP_060484
MIM 606557
Uniprot ID Q9H165
Chromosome Location 2p16.1
Function metal ion binding; nucleic acid binding; protein heterodimerization activity; protein homodimerization activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL11A Products

Required fields are marked with *

My Review for All BCL11A Products

Required fields are marked with *

0
cart-icon