Recombinant Human BCL11A

• Cat.No.: BCL11A-28026TH
• Product Overview: Recombinant fragment of Human Ctip1 (amino acids 1-88) with proprietary tag at N-terminal,.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 88 amino acids
• Description: This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene.
• Molecular Weight: 35.310kDa inclusive of tags
• Tissue specificity: Expressed at high levels in brain, spleen thymus, bone marrow and testis. Expressed in CD34-positive myeloid precursor cells, B-cells, monocytes and megakaryocytes. Expression is tightly regulated during B-cell development.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
• Sequence Similarities: Contains 6 C2H2-type zinc fingers.

Gene Information

• Gene Name: BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) [ Homo sapiens ]
• Official Symbol: BCL11A
• Synonyms: BCL11A; B-cell CLL/lymphoma 11A (zinc finger protein); ecotropic viral integration site 9 , EVI9; B-cell lymphoma/leukemia 11A; BCL11A L; BCL11A S; BCL11A XL; CTIP1; HBFQTL5; ZNF856
• Gene ID: 53335
• mRNA Refseq: NM_018014
• Protein Refseq: NP_060484
• MIM: 606557
• Uniprot ID: Q9H165
• Chromosome Location: 2p16.1
• Function: metal ion binding; nucleic acid binding; protein heterodimerization activity; protein homodimerization activity; zinc ion binding