Recombinant Human BCL11A
Cat.No. : | BCL11A-28026TH |
Product Overview : | Recombinant fragment of Human Ctip1 (amino acids 1-88) with proprietary tag at N-terminal,. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 88 amino acids |
Description : | This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. |
Molecular Weight : | 35.310kDa inclusive of tags |
Tissue specificity : | Expressed at high levels in brain, spleen thymus, bone marrow and testis. Expressed in CD34-positive myeloid precursor cells, B-cells, monocytes and megakaryocytes. Expression is tightly regulated during B-cell development. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS |
Sequence Similarities : | Contains 6 C2H2-type zinc fingers. |
Gene Name | BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) [ Homo sapiens ] |
Official Symbol | BCL11A |
Synonyms | BCL11A; B-cell CLL/lymphoma 11A (zinc finger protein); ecotropic viral integration site 9 , EVI9; B-cell lymphoma/leukemia 11A; BCL11A L; BCL11A S; BCL11A XL; CTIP1; HBFQTL5; ZNF856; |
Gene ID | 53335 |
mRNA Refseq | NM_018014 |
Protein Refseq | NP_060484 |
MIM | 606557 |
Uniprot ID | Q9H165 |
Chromosome Location | 2p16.1 |
Function | metal ion binding; nucleic acid binding; protein heterodimerization activity; protein homodimerization activity; zinc ion binding; |
◆ Recombinant Proteins | ||
BCL11A-142H | Recombinant Human BCL11A Protein, GST-tagged | +Inquiry |
BCL11A-2711C | Recombinant Chicken BCL11A | +Inquiry |
BCL11A-28026TH | Recombinant Human BCL11A | +Inquiry |
Bcl11a-984M | Recombinant Mouse Bcl11a Protein, MYC/DDK-tagged | +Inquiry |
BCL11A-2470H | Recombinant Human BCL11A Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL11A-164HCL | Recombinant Human BCL11A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL11A Products
Required fields are marked with *
My Review for All BCL11A Products
Required fields are marked with *
0
Inquiry Basket