Recombinant Human BCL2 protein, His-tagged
| Cat.No. : | BCL2-7855H |
| Product Overview : | Recombinant Human BCL2 protein(101-239 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Tag : | His |
| Protein Length : | 101-239 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |
| Gene Name | BCL2 B-cell CLL/lymphoma 2 [ Homo sapiens ] |
| Official Symbol | BCL2 |
| Synonyms | BCL2; B-cell CLL/lymphoma 2; apoptosis regulator Bcl-2; Bcl 2; PPP1R50; protein phosphatase 1; regulatory subunit 50; protein phosphatase 1, regulatory subunit 50; Bcl-2; |
| Gene ID | 596 |
| mRNA Refseq | NM_000633 |
| Protein Refseq | NP_000624 |
| UniProt ID | P10415 |
| ◆ Recombinant Proteins | ||
| BCL2-1213H | Recombinant Human BCL2 protein, His-tagged | +Inquiry |
| BCL2-2469H | Recombinant Human BCL2 Protein, MYC/DDK-tagged | +Inquiry |
| BCL2-5298H | Recombinant Human B-cell CLL/lymphoma 2, GST-tagged | +Inquiry |
| BCL2-5732D | Recombinant Dog BCL2 protein, His-tagged | +Inquiry |
| Bcl2-6743M | Recombinant Mouse Bcl2 protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2 Products
Required fields are marked with *
My Review for All BCL2 Products
Required fields are marked with *
