Recombinant Human BCL2L14 Protein, GST-tagged
| Cat.No. : | BCL2L14-155H |
| Product Overview : | Human BCL2L14 full-length ORF ( AAH25778.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has been shown to induce apoptosis in cells. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported for this gene. [provided by RefSeq |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 61.71 kDa |
| AA Sequence : | MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCL2L14 BCL2-like 14 (apoptosis facilitator) [ Homo sapiens ] |
| Official Symbol | BCL2L14 |
| Synonyms | BCL2L14; BCL2-like 14 (apoptosis facilitator); apoptosis facilitator Bcl-2-like protein 14; BCL G; BCLG; bcl2-L-14; apoptosis regulator BCL-G; |
| Gene ID | 79370 |
| mRNA Refseq | NM_030766 |
| Protein Refseq | NP_110393 |
| MIM | 606126 |
| UniProt ID | Q9BZR8 |
| ◆ Recombinant Proteins | ||
| BCL2L14-4915H | Recombinant Human BCL2L14 protein, GST-tagged | +Inquiry |
| BCL2L14-155H | Recombinant Human BCL2L14 Protein, GST-tagged | +Inquiry |
| BCL2L14-961R | Recombinant Rat BCL2L14 Protein | +Inquiry |
| Bcl2l14-1849M | Recombinant Mouse Bcl2l14 Protein, Myc/DDK-tagged | +Inquiry |
| BCL2L14-10182H | Recombinant Human BCL2L14, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCL2L14-8484HCL | Recombinant Human BCL2L14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2L14 Products
Required fields are marked with *
My Review for All BCL2L14 Products
Required fields are marked with *
