Recombinant Human BCL7A protein, His&Myc-tagged
| Cat.No. : | BCL7A-5634H |
| Product Overview : | Recombinant Human BCL7A protein(Q4VC05)(1-210aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-210a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.3 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM |
| Gene Name | BCL7A B-cell CLL/lymphoma 7A [ Homo sapiens ] |
| Official Symbol | BCL7A |
| Synonyms | BCL7A; B-cell CLL/lymphoma 7A; BCL7; B-cell CLL/lymphoma 7 protein family member A; B-cell CLL/lymphoma-7; |
| Gene ID | 605 |
| mRNA Refseq | NM_001024808 |
| Protein Refseq | NP_001019979 |
| MIM | 601406 |
| UniProt ID | Q4VC05 |
| ◆ Recombinant Proteins | ||
| BCL7A-1550HF | Recombinant Full Length Human BCL7A Protein, GST-tagged | +Inquiry |
| BCL7A-2353M | Recombinant Mouse BCL7A Protein | +Inquiry |
| BCL7A-2465H | Recombinant Human BCL7A Protein, MYC/DDK-tagged | +Inquiry |
| Bcl7a-1851M | Recombinant Mouse Bcl7a Protein, Myc/DDK-tagged | +Inquiry |
| BCL7A-7072H | Recombinant Human BCL7A, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL7A Products
Required fields are marked with *
My Review for All BCL7A Products
Required fields are marked with *
