Recombinant Human BCLAF1 protein, His-tagged
Cat.No. : | BCLAF1-3495H |
Product Overview : | Recombinant Human BCLAF1 protein(881-920 aa), fused to His tag, was expressed in E. coli. |
Availability | September 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 881-920 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BCLAF1 BCL2-associated transcription factor 1 [ Homo sapiens ] |
Official Symbol | BCLAF1 |
Synonyms | BCLAF1; BCL2-associated transcription factor 1; bcl-2-associated transcription factor 1; BTF; KIAA0164; bK211L9.1; |
Gene ID | 9774 |
mRNA Refseq | NM_001077440 |
Protein Refseq | NP_001070908 |
MIM | 612588 |
UniProt ID | Q9NYF8 |
◆ Recombinant Proteins | ||
BCLAF1-301423H | Recombinant Human BCLAF1 protein, GST-tagged | +Inquiry |
BCLAF1-2358M | Recombinant Mouse BCLAF1 Protein | +Inquiry |
BCLAF1-1003M | Recombinant Mouse BCLAF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BCLAF1-3495H | Recombinant Human BCLAF1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCLAF1-8475HCL | Recombinant Human BCLAF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCLAF1 Products
Required fields are marked with *
My Review for All BCLAF1 Products
Required fields are marked with *