Recombinant Human BCOR protein, His-tagged
| Cat.No. : | BCOR-2974H |
| Product Overview : | Recombinant Human BCOR protein(2-361 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-361 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | RFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANPPGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSDLASDNYW |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | BCOR BCL6 corepressor [ Homo sapiens ] |
| Official Symbol | BCOR |
| Synonyms | BCOR; BCL6 corepressor; BCL6 co repressor; BCL-6 corepressor; FLJ20285; KIAA1575; BCL6 co-repressor; BCL-6 interacting corepressor; MAA2; ANOP2; MCOPS2; FLJ38041; MGC71031; MGC131961; |
| Gene ID | 54880 |
| mRNA Refseq | NM_001123383 |
| Protein Refseq | NP_001116855 |
| MIM | 300485 |
| UniProt ID | Q6W2J9 |
| ◆ Recombinant Proteins | ||
| BCOR-10194H | Recombinant Human BCOR, GST-tagged | +Inquiry |
| BCOR-174H | Recombinant Human BCOR Protein, GST-tagged | +Inquiry |
| BCOR-0474H | Recombinant Human BCOR Protein (Met1569-Trp1755), N-His-tagged | +Inquiry |
| BCOR-2974H | Recombinant Human BCOR protein, His-tagged | +Inquiry |
| Bcor-557M | Recombinant Mouse Bcor Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCOR-8473HCL | Recombinant Human BCOR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCOR Products
Required fields are marked with *
My Review for All BCOR Products
Required fields are marked with *
