Recombinant Human BDNF protein, GST-tagged
| Cat.No. : | BDNF-2586H |
| Product Overview : | Recombinant Human BDNF protein(P23560)(137-237aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 137-237aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 38.5 kDa |
| AA Sequence : | ELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | BDNF brain-derived neurotrophic factor [ Homo sapiens ] |
| Official Symbol | BDNF |
| Synonyms | BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632; |
| Gene ID | 627 |
| mRNA Refseq | NM_001143805 |
| Protein Refseq | NP_001137277 |
| MIM | 113505 |
| UniProt ID | P23560 |
| ◆ Recombinant Proteins | ||
| BDNF-551P | Recombinant Pig BDNF protein, His-tagged | +Inquiry |
| BDNF-545D | Recombinant Dog BDNF protein, His-tagged | +Inquiry |
| BDNF-258H | Recombinant Human BDNF protein | +Inquiry |
| BDNF-9843M | Active Recombinant Mouse BDNF protein, His-tagged | +Inquiry |
| Bdnf-703M | Recombinant Mouse Bdnf Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BDNF-001MCL | Recombinant Mouse BDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BDNF Products
Required fields are marked with *
My Review for All BDNF Products
Required fields are marked with *
