Recombinant Human BDNF protein, His-tagged
Cat.No. : | BDNF-2555H |
Product Overview : | Recombinant Human BDNF protein(130-179 aa), fused to His tag, was expressed in E. coli. |
Availability | September 27, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 130-179 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BDNF brain-derived neurotrophic factor [ Homo sapiens ] |
Official Symbol | BDNF |
Synonyms | BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632; |
Gene ID | 627 |
mRNA Refseq | NM_001143805 |
Protein Refseq | NP_001137277 |
MIM | 113505 |
UniProt ID | P23560 |
◆ Recombinant Proteins | ||
BDNF-007H | Active Recombinant Human BDNF Protein | +Inquiry |
BDNF-553R | Recombinant Rabbit BDNF protein, His-tagged | +Inquiry |
BDNF-72H | Recombinant Human BDNF protein | +Inquiry |
Bdnf-548G | Recombinant Guinea pig Bdnf protein, His & GST-tagged | +Inquiry |
BDNF-003H | Active Recombinant Human BDNF | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDNF-001MCL | Recombinant Mouse BDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BDNF Products
Required fields are marked with *
My Review for All BDNF Products
Required fields are marked with *