Recombinant Human BEND3 Protein (328-461 aa), GST-tagged
| Cat.No. : | BEND3-1036H |
| Product Overview : | Recombinant Human BEND3 Protein (328-461 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 328-461 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 42.5 kDa |
| AA Sequence : | CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | BEND3 BEN domain containing 3 [ Homo sapiens ] |
| Official Symbol | BEND3 |
| Synonyms | KIAA1553; RP11-59I9.2; |
| Gene ID | 57673 |
| mRNA Refseq | NM_001080450.2 |
| Protein Refseq | NP_001073919.1 |
| UniProt ID | Q5T5X7 |
| ◆ Recombinant Proteins | ||
| Bend3-1857M | Recombinant Mouse Bend3 Protein, Myc/DDK-tagged | +Inquiry |
| BEND3-3478H | Recombinant Human BEND3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BEND3-1674H | Recombinant Human BEND3 Protein (328-461 aa), His-tagged | +Inquiry |
| BEND3-2463H | Recombinant Human BEND3 Protein, MYC/DDK-tagged | +Inquiry |
| BEND3-1036H | Recombinant Human BEND3 Protein (328-461 aa), GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BEND3 Products
Required fields are marked with *
My Review for All BEND3 Products
Required fields are marked with *



