Recombinant Human BIK Protein, GST-tagged

Cat.No. : BIK-220H
Product Overview : Human BIK partial ORF ( AAH01599, 37 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is known to interact with cellular and viral survival-promoting proteins, such as BCL2 and the Epstein-Barr virus in order to enhance programed cell death. Because its activity is suppressed in the presence of survival-promoting proteins, this protein is suggested as a likely target for antiapoptotic proteins. This protein shares a critical BH3 domain with other death-promoting proteins, BAX and BAK.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : EDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQV
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BIK BCL2-interacting killer (apoptosis-inducing) [ Homo sapiens ]
Official Symbol BIK
Synonyms BIK; BCL2-interacting killer (apoptosis-inducing); bcl-2-interacting killer; NBK; apoptosis inducer NBK; apoptosis-inducing NBK; BP4; BIP1;
Gene ID 638
mRNA Refseq NM_001197
Protein Refseq NP_001188
MIM 603392
UniProt ID Q13323

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BIK Products

Required fields are marked with *

My Review for All BIK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon