| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
96-439 a.a. |
| Description : |
This gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynamin, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in ten transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described. |
| Conjugation : |
HIS |
| Tissue specificity : |
Ubiquitous. Highest expression in the brain and muscle. Isoform IIA is expressed only in the brain where it is concentrated in axon initial segments and nodes of Ranvier. Isoform BIN1 is widely expressed with highest expression in skeletal muscle. |
| Form : |
Lyophilised:Reconstitute with 118 μl aqua dest |
| Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
GRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPD IKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAK AEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTF QSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFT VKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAG GATPGATLPKSPSQPAEASEVAGGTQPAAGAQEPGETA ASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPP GFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEE QDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP |
| Sequence Similarities : |
Contains 1 BAR domain.Contains 1 SH3 domain. |