Recombinant Human BIRC5 protein(41-130 aa), C-His-tagged

Cat.No. : BIRC5-2464H
Product Overview : Recombinant Human BIRC5 protein(O15392)(41-130 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 41-130 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : AGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKK
Gene Name BIRC5 baculoviral IAP repeat containing 5 [ Homo sapiens ]
Official Symbol BIRC5
Synonyms BIRC5; baculoviral IAP repeat containing 5; API4, apoptosis inhibitor 4 , baculoviral IAP repeat containing 5; baculoviral IAP repeat-containing protein 5; EPR 1; survivin; survivin variant 3 alpha; apoptosis inhibitor 4; apoptosis inhibitor survivin; API4; EPR-1;
Gene ID 332
mRNA Refseq NM_001012270
Protein Refseq NP_001012270
MIM 603352
UniProt ID O15392

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BIRC5 Products

Required fields are marked with *

My Review for All BIRC5 Products

Required fields are marked with *

0
cart-icon