Recombinant Human BIRC5 protein(41-130 aa), C-His-tagged
| Cat.No. : | BIRC5-2464H |
| Product Overview : | Recombinant Human BIRC5 protein(O15392)(41-130 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 41-130 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | AGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKK |
| Gene Name | BIRC5 baculoviral IAP repeat containing 5 [ Homo sapiens ] |
| Official Symbol | BIRC5 |
| Synonyms | BIRC5; baculoviral IAP repeat containing 5; API4, apoptosis inhibitor 4 , baculoviral IAP repeat containing 5; baculoviral IAP repeat-containing protein 5; EPR 1; survivin; survivin variant 3 alpha; apoptosis inhibitor 4; apoptosis inhibitor survivin; API4; EPR-1; |
| Gene ID | 332 |
| mRNA Refseq | NM_001012270 |
| Protein Refseq | NP_001012270 |
| MIM | 603352 |
| UniProt ID | O15392 |
| ◆ Recombinant Proteins | ||
| BIRC5-5592H | Recombinant Human BIRC5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Birc5-162M | Recombinant Mouse Birc5 Protein, His-tagged | +Inquiry |
| BIRC5-047H | Recombinant Human BIRC5 Protein | +Inquiry |
| BIRC5-17M | Recombinant Mouse BIRC5 Protein, His-tagged | +Inquiry |
| BIRC5-04HFL | Recombinant Full Length Human BIRC5 Protein, His&TEV tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BIRC5-8449HCL | Recombinant Human BIRC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BIRC5 Products
Required fields are marked with *
My Review for All BIRC5 Products
Required fields are marked with *
