Recombinant Mouse BIRC5 Protein, His-tagged

Cat.No. : BIRC5-17M
Product Overview : Recombinant Mouse BIRC5 Protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. In humans, gene expression is high during fetal development and in most tumors yet low in adult tissues. Antisense transcripts have been identified in human that regulate this gene's expression. At least three transcript variants encoding distinct isoforms have been found for this gene, although at least one of these transcript variants is a nonsense-mediated decay (NMD) candidate.
Form : Lyophilized from sterile PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin 300.
Molecular Mass : 17.25 kDa
AA Sequence : MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAAMHHHHHH
Endotoxin : <1EU/ug
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Gene Name Birc5 baculoviral IAP repeat-containing 5 [ Mus musculus (house mouse) ]
Official Symbol Birc5
Synonyms Api4; TIAP; AAC-11; survivin40
Gene ID 11799
mRNA Refseq NM_009689
Protein Refseq NP_033819
MIM 603352
UniProt ID O70201

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BIRC5 Products

Required fields are marked with *

My Review for All BIRC5 Products

Required fields are marked with *

0
cart-icon