Recombinant Human BIRC5 Protein, GST-tagged
Cat.No. : | BIRC5-229H |
Product Overview : | Human BIRC5 partial ORF ( NP_001159, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors yet low in adult tissues. Antisense transcripts are involved in the regulation of this genes expression. At least four transcript variants encoding distinct isoforms have been found for this gene, but the full-length natures of only three of them have been determined. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGE |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BIRC5 baculoviral IAP repeat containing 5 [ Homo sapiens ] |
Official Symbol | BIRC5 |
Synonyms | BIRC5; baculoviral IAP repeat containing 5; API4, apoptosis inhibitor 4 , baculoviral IAP repeat containing 5; baculoviral IAP repeat-containing protein 5; EPR 1; survivin; survivin variant 3 alpha; apoptosis inhibitor 4; apoptosis inhibitor survivin; API4; EPR-1; |
Gene ID | 332 |
mRNA Refseq | NM_001012270 |
Protein Refseq | NP_001012270 |
MIM | 603352 |
UniProt ID | O15392 |
◆ Recombinant Proteins | ||
BIRC5-7313HFL | Recombinant Full Length Human BIRC5 protein, Flag-tagged | +Inquiry |
BIRC5-2465H | Recombinant Human BIRC5 protein(41-130 aa), N-mSUMO & C-His-tagged | +Inquiry |
BIRC5-31485TH | Recombinant Human BIRC5 protein | +Inquiry |
BIRC5-93C | Recombinant Cynomolgus Monkey BIRC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
BIRC5-0718H | Recombinant Human BIRC5 Protein (M1-D142), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
BIRC5-8449HCL | Recombinant Human BIRC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BIRC5 Products
Required fields are marked with *
My Review for All BIRC5 Products
Required fields are marked with *