Recombinant Human BIRC6 Protein, GST-tagged

Cat.No. : BIRC6-230H
Product Overview : Human BIRC6 partial ORF ( NP_057336, 31 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein with a BIR (baculoviral inhibition of apoptosis protein repeat) domain and a UBCc (ubiquitin-conjugating enzyme E2, catalytic) domain. This protein inhibits apoptosis by facilitating the degradation of apoptotic proteins by ubiquitination.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : RDGCMHCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKCQYISAVDKVIFVDDYAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVT
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BIRC6 baculoviral IAP repeat containing 6 [ Homo sapiens ]
Official Symbol BIRC6
Synonyms BIRC6; baculoviral IAP repeat containing 6; baculoviral IAP repeat-containing protein 6; apollon; BRUCE; baculoviral IAP repeat-containing 6; ubiquitin-conjugating BIR domain enzyme apollon; ubiquitin-conjugating BIR-domain enzyme apollon; BIR repeat-containing ubiquitin-conjugating enzyme; APOLLON; FLJ13726; FLJ13786; KIAA1289;
Gene ID 57448
mRNA Refseq NM_016252
Protein Refseq NP_057336
MIM 605638
UniProt ID Q9NR09

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BIRC6 Products

Required fields are marked with *

My Review for All BIRC6 Products

Required fields are marked with *

0
cart-icon