Recombinant Human BIRC6 Protein, GST-tagged

• Cat.No.: BIRC6-230H
• Product Overview: Human BIRC6 partial ORF ( NP_057336, 31 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein with a BIR (baculoviral inhibition of apoptosis protein repeat) domain and a UBCc (ubiquitin-conjugating enzyme E2, catalytic) domain. This protein inhibits apoptosis by facilitating the degradation of apoptotic proteins by ubiquitination.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.84 kDa
• AA Sequence: RDGCMHCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKCQYISAVDKVIFVDDYAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVT
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BIRC6 baculoviral IAP repeat containing 6 [ Homo sapiens ]
• Official Symbol: BIRC6
• Synonyms: BIRC6; baculoviral IAP repeat containing 6; baculoviral IAP repeat-containing protein 6; apollon; BRUCE; baculoviral IAP repeat-containing 6; ubiquitin-conjugating BIR domain enzyme apollon; ubiquitin-conjugating BIR-domain enzyme apollon; BIR repeat-containing ubiquitin-conjugating enzyme; APOLLON; FLJ13726; FLJ13786; KIAA1289
• Gene ID: 57448
• mRNA Refseq: NM_016252
• Protein Refseq: NP_057336
• MIM: 605638
• UniProt ID: Q9NR09