Recombinant Human BLID Protein (1-108 aa), GST-tagged

Cat.No. : BLID-2136H
Product Overview : Recombinant Human BLID Protein (1-108 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-108 aa
Description : Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 39.0 kDa
AA Sequence : MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name BLID BH3-like motif containing, cell death inducer [ Homo sapiens ]
Official Symbol BLID
Synonyms BLID; BRCC2; breast cancer cell 2; MGC163233; MGC163235;
Gene ID 414899
mRNA Refseq NM_001001786
Protein Refseq NP_001001786
MIM 608853
UniProt ID Q8IZY5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BLID Products

Required fields are marked with *

My Review for All BLID Products

Required fields are marked with *

0
cart-icon
0
compare icon