Recombinant Human BLID Protein (1-108 aa), GST-tagged

• Cat.No.: BLID-2136H
• Product Overview: Recombinant Human BLID Protein (1-108 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-108 aa
• Description: Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 39.0 kDa
• AA Sequence: MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: BLID BH3-like motif containing, cell death inducer [ Homo sapiens ]
• Official Symbol: BLID
• Synonyms: BLID; BRCC2; breast cancer cell 2; MGC163233; MGC163235
• Gene ID: 414899
• mRNA Refseq: NM_001001786
• Protein Refseq: NP_001001786
• MIM: 608853
• UniProt ID: Q8IZY5