Recombinant Human BLID Protein (1-108 aa), GST-tagged
Cat.No. : | BLID-2136H |
Product Overview : | Recombinant Human BLID Protein (1-108 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-108 aa |
Description : | Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 39.0 kDa |
AA Sequence : | MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | BLID BH3-like motif containing, cell death inducer [ Homo sapiens ] |
Official Symbol | BLID |
Synonyms | BLID; BRCC2; breast cancer cell 2; MGC163233; MGC163235; |
Gene ID | 414899 |
mRNA Refseq | NM_001001786 |
Protein Refseq | NP_001001786 |
MIM | 608853 |
UniProt ID | Q8IZY5 |
◆ Recombinant Proteins | ||
BLID-2136H | Recombinant Human BLID Protein (1-108 aa), GST-tagged | +Inquiry |
BLID-1644HF | Recombinant Full Length Human BLID Protein, GST-tagged | +Inquiry |
BLID-237H | Recombinant Human BLID Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLID-176HCL | Recombinant Human BLID cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLID Products
Required fields are marked with *
My Review for All BLID Products
Required fields are marked with *