Recombinant Human BLID Protein, GST-tagged

Cat.No. : BLID-237H
Product Overview : Human BLID full-length ORF ( NP_001001786.1, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a BH3-like motif containing protein involved in cell death. The encoded protein may induce apoptosis in a caspase-dependent manner. The protein is localized in both the cytoplasm and the mitochondrion.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 38.4 kDa
AA Sequence : MVTLLPIEGQEVHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BLID BH3-like motif containing, cell death inducer [ Homo sapiens ]
Official Symbol BLID
Synonyms BLID; BH3-like motif containing, cell death inducer; BH3-like motif-containing cell death inducer; BRCC2; breast cancer cell 2; breast cancer cell protein 2; MGC163233; MGC163235;
Gene ID 414899
mRNA Refseq NM_001001786
Protein Refseq NP_001001786
MIM 608853
UniProt ID Q8IZY5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BLID Products

Required fields are marked with *

My Review for All BLID Products

Required fields are marked with *

0
cart-icon