Recombinant Human BLID Protein, GST-tagged

• Cat.No.: BLID-237H
• Product Overview: Human BLID full-length ORF ( NP_001001786.1, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a BH3-like motif containing protein involved in cell death. The encoded protein may induce apoptosis in a caspase-dependent manner. The protein is localized in both the cytoplasm and the mitochondrion.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 38.4 kDa
• AA Sequence: MVTLLPIEGQEVHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BLID BH3-like motif containing, cell death inducer [ Homo sapiens ]
• Official Symbol: BLID
• Synonyms: BLID; BH3-like motif containing, cell death inducer; BH3-like motif-containing cell death inducer; BRCC2; breast cancer cell 2; breast cancer cell protein 2; MGC163233; MGC163235
• Gene ID: 414899
• mRNA Refseq: NM_001001786
• Protein Refseq: NP_001001786
• MIM: 608853
• UniProt ID: Q8IZY5