Recombinant Human BLID Protein, GST-tagged
| Cat.No. : | BLID-237H |
| Product Overview : | Human BLID full-length ORF ( NP_001001786.1, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a BH3-like motif containing protein involved in cell death. The encoded protein may induce apoptosis in a caspase-dependent manner. The protein is localized in both the cytoplasm and the mitochondrion. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 38.4 kDa |
| AA Sequence : | MVTLLPIEGQEVHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BLID BH3-like motif containing, cell death inducer [ Homo sapiens ] |
| Official Symbol | BLID |
| Synonyms | BLID; BH3-like motif containing, cell death inducer; BH3-like motif-containing cell death inducer; BRCC2; breast cancer cell 2; breast cancer cell protein 2; MGC163233; MGC163235; |
| Gene ID | 414899 |
| mRNA Refseq | NM_001001786 |
| Protein Refseq | NP_001001786 |
| MIM | 608853 |
| UniProt ID | Q8IZY5 |
| ◆ Recombinant Proteins | ||
| BLID-1644HF | Recombinant Full Length Human BLID Protein, GST-tagged | +Inquiry |
| BLID-2136H | Recombinant Human BLID Protein (1-108 aa), GST-tagged | +Inquiry |
| BLID-237H | Recombinant Human BLID Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BLID-176HCL | Recombinant Human BLID cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLID Products
Required fields are marked with *
My Review for All BLID Products
Required fields are marked with *
