Recombinant Human BLK Protein, His-tagged

Cat.No. : BLK-770H
Product Overview : Recombinant Human BLK fused with His tag at C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a nonreceptor tyrosine-kinase of the src family of proto-oncogenes that are typically involved in cell proliferation and differentiation. The protein has a role in B-cell receptor signaling and B-cell development. The protein also stimulates insulin synthesis and secretion in response to glucose and enhances the expression of several pancreatic beta-cell transcription factors.
Form : Supplied as a 0.2 µM filtered solution of 20mM Tris, 500mM NaCl, 1mM DTT, pH 7.4
Molecular Mass : 58.7kD
AA Sequence : MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIRCLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQSLRLVRKLGSGQFGEV
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name BLK B lymphoid tyrosine kinase [ Homo sapiens ]
Official Symbol BLK
Synonyms BLK; B lymphoid tyrosine kinase; tyrosine-protein kinase Blk; MGC10442; p55-Blk; b lymphocyte kinase; BLK nonreceptor tyrosine kinase; MODY11;
Gene ID 640
mRNA Refseq NM_001715
Protein Refseq NP_001706
MIM 191305
UniProt ID P51451

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BLK Products

Required fields are marked with *

My Review for All BLK Products

Required fields are marked with *

0
cart-icon