Recombinant Human BLK Protein, His-tagged

• Cat.No.: BLK-770H
• Product Overview: Recombinant Human BLK fused with His tag at C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a nonreceptor tyrosine-kinase of the src family of proto-oncogenes that are typically involved in cell proliferation and differentiation. The protein has a role in B-cell receptor signaling and B-cell development. The protein also stimulates insulin synthesis and secretion in response to glucose and enhances the expression of several pancreatic beta-cell transcription factors.
• Form: Supplied as a 0.2 µM filtered solution of 20mM Tris, 500mM NaCl, 1mM DTT, pH 7.4
• Molecular Mass: 58.7kD
• AA Sequence: MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIRCLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQSLRLVRKLGSGQFGEV
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: BLK B lymphoid tyrosine kinase [ Homo sapiens ]
• Official Symbol: BLK
• Synonyms: BLK; B lymphoid tyrosine kinase; tyrosine-protein kinase Blk; MGC10442; p55-Blk; b lymphocyte kinase; BLK nonreceptor tyrosine kinase; MODY11
• Gene ID: 640
• mRNA Refseq: NM_001715
• Protein Refseq: NP_001706
• MIM: 191305
• UniProt ID: P51451