Recombinant Human BLMH Protein, GST-tagged
Cat.No. : | BLMH-243H |
Product Overview : | Human BLMH partial ORF ( NP_000377, 356 a.a. - 454 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | NMNKAERLTFGESLMTHAMTFTAVSEKDDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALA |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BLMH bleomycin hydrolase [ Homo sapiens ] |
Official Symbol | BLMH |
Synonyms | BLMH; bleomycin hydrolase; BH; BLM hydrolase; BMH; |
Gene ID | 642 |
mRNA Refseq | NM_000386 |
Protein Refseq | NP_000377 |
MIM | 602403 |
UniProt ID | Q13867 |
◆ Recombinant Proteins | ||
BLMH-418H | Recombinant Human BLMH Protein, His-tagged | +Inquiry |
BLMH-1155H | Recombinant Human BLMH, His tagged | +Inquiry |
BLMH-0765H | Recombinant Human BLMH Protein (Met213-Trp447), His tagged | +Inquiry |
BLMH-10377Z | Recombinant Zebrafish BLMH | +Inquiry |
Blmh-419M | Recombinant Mouse Blmh Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLMH-8445HCL | Recombinant Human BLMH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLMH Products
Required fields are marked with *
My Review for All BLMH Products
Required fields are marked with *
0
Inquiry Basket