Recombinant Human BLNK Protein, His-tagged
| Cat.No. : | BLNK-001H |
| Product Overview : | Recombinant Human BLNK Protein, His-tagged, expressed in E.coli. |
| Availability | November 04, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 226-456 aa |
| Tag : | C-His |
| Molecular Mass : | 27 kDa |
| AA Sequence : | MGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVSHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1mg/ml by BCA |
| Storage Buffer : | Sterile PBS, pH 7.4 |
| GeneID : | 29760 |
| Gene Name | BLNK B cell linker [ Homo sapiens (human) ] |
| Official Symbol | BLNK |
| Synonyms | bca,AGM4,BASH, LY57,SLP65,BLNK-S,SLP-65,BLNK |
| MIM | 604515 |
| UniProt ID | Q8WV28 |
| ◆ Recombinant Proteins | ||
| BLNK-6470C | Recombinant Chicken BLNK | +Inquiry |
| BLNK-26279TH | Recombinant Human BLNK Protein, His-tagged | +Inquiry |
| BLNK-2417M | Recombinant Mouse BLNK Protein | +Inquiry |
| BLNK-406H | Recombinant Human BLNK Protein, His-tagged | +Inquiry |
| BLNK-988R | Recombinant Rat BLNK Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BLNK-1858HCL | Recombinant Human BLNK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLNK Products
Required fields are marked with *
My Review for All BLNK Products
Required fields are marked with *
