Recombinant Human BLNK Protein, His-tagged
Cat.No. : | BLNK-001H |
Product Overview : | Recombinant Human BLNK Protein, His-tagged, expressed in E.coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 226-456 aa |
Tag : | C-His |
Molecular Mass : | 27 kDa |
AA Sequence : | MGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVSHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH 7.4 |
GeneID : | 29760 |
Gene Name | BLNK B cell linker [ Homo sapiens (human) ] |
Official Symbol | BLNK |
Synonyms | bca,AGM4,BASH, LY57,SLP65,BLNK-S,SLP-65,BLNK |
MIM | 604515 |
UniProt ID | Q8WV28 |
◆ Recombinant Proteins | ||
BLNK-245H | Recombinant Human BLNK Protein, GST-tagged | +Inquiry |
BLNK-1709HF | Recombinant Full Length Human BLNK Protein, GST-tagged | +Inquiry |
BLNK-12102Z | Recombinant Zebrafish BLNK | +Inquiry |
BLNK-988R | Recombinant Rat BLNK Protein | +Inquiry |
BLNK-0735H | Recombinant Human BLNK Protein (Met1-Ser456), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLNK-1858HCL | Recombinant Human BLNK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLNK Products
Required fields are marked with *
My Review for All BLNK Products
Required fields are marked with *
0
Inquiry Basket